DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4B1 and Cyp6a22

DIOPT Version :9

Sequence 1:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens
Sequence 2:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster


Alignment Length:465 Identity:112/465 - (24%)
Similarity:202/465 - (43%) Gaps:86/465 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    88 FIGFLNIYEP----------------DYA----KAVY--SRGDPKAPDVYDFFLQWIGRGLLVLE 130
            |.||..:..|                |:|    :.:|  .|.||            :...|..::
  Fly    70 FAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDP------------LTGHLFRID 122

Human   131 GPKWLQHRKLLTPGFHYDVLK---PYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHM----A 188
            ||||...|:.::|.|....:|   |.|....|....:..:..:.|..|     ..::|.:    .
  Fly   123 GPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCG-----ILEIGDLMARYT 182

Human   189 LNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYH----NDFIYWLTPHGRRFLR 249
            .:.:.:|.||....||   |:.....|:      |.:|..|.:.|    :.||... |...||||
  Fly   183 SDVIGRCAFGVECNGL---RNPEAEFAI------MGRRAFSERRHCKLVDGFIESF-PEVARFLR 237

Human   250 ACQVAHDHTD---QVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVD 311
            ..|:..|.||   .::||.....:::.:.:.       ||:::|:..:...::.:.  ::.|:..
  Fly   238 MRQIHQDITDFYVGIVRETVKQREEQGIVRS-------DFMNLLIEMKQRGELTIE--EMAAQAF 293

Human   312 TFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREIL----GDQDFFQWDDLGKMTYLTMCIK 372
            .|...|.||:.|.:.:.||.:|..|..|.:.|||:.:.|    |:   |.:|.:.::.|:.:.|.
  Fly   294 IFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGE---FTYDSMQELRYMELVIA 355

Human   373 ESFRLYPPVPQVYRQLSKPVTFVDGRS---LPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTE 434
            |:.|.||.:||:.| :|:.:....|..   :..|.::.:.:|.:|.:.|::|:|..|...||..:
  Fly   356 ETLRKYPILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLAD 419

Human   435 NASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDP---SRLPIKMPQLVLRSK 496
            ..::|...|::||..|||||||.:|...:..:.....|..|.||:.|   .::......::|...
  Fly   420 QLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPA 484

Human   497 NGFHLHLKPL 506
            ||.:|.::.|
  Fly   485 NGIYLKVQQL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 110/458 (24%)
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 111/460 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.