DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4B1 and Cyp9f2

DIOPT Version :9

Sequence 1:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens
Sequence 2:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster


Alignment Length:452 Identity:111/452 - (24%)
Similarity:186/452 - (41%) Gaps:69/452 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    85 FGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYDV 149
            |..||...|::      |..|..||.  |:.:.|    |..|..:...:|...|..|:|.|....
  Fly    97 FDHFINHRNVF------ATSSDDDPH--DMSNLF----GSSLFSMRDARWKDMRSTLSPAFTGSK 149

Human   150 LKPYVAVFTESTRIMLD--KWEEKAREGKSFDI--FCDVGHMALNTLMKCTFGRGDTGLGHSRDS 210
            ::....:..:..:..:|  |.::...:....|:  :|.  ....:.:....||. .......|::
  Fly   150 MRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCT--RFTNDVIASTAFGL-QVNSFKDREN 211

Human   211 SYYLAVSDLTLLMQQRLVSFQYHND--FIYWLTPHG-RRFLRACQVAHDHTDQVIRERKAALQDE 272
            ::|        .|.::|.:|.:...  |:.:....| .:.|:........|...:|   ..|...
  Fly   212 TFY--------QMGKKLTTFTFLQSMKFMLFFALKGLNKILKVELFDRKSTQYFVR---LVLDAM 265

Human   273 KVRKKIQNRRHLDFLDILLGAR---DEDDIKL------SDADLRAEVDTFMFEGHDTTTSGISWF 328
            |.|:: .|....|.:::|:.||   ..:..|.      ||.|:.|:...|.|.|.:|     |..
  Fly   266 KYRQE-HNIVRPDMINMLMEARGIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFET-----SAV 324

Human   329 LYCMALY-----PEHQHRCREEVREILGDQDF----FQWDDLGKMTYLTMCIKESFRLYPPVPQV 384
            |.|...:     .:.|.|..|||:::  |||.    ..::.:..|.||...:.|..|.:|....|
  Fly   325 LMCFTAHELMENQDVQQRLYEEVQQV--DQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAV 387

Human   385 YRQLSKPVTF-VDGRSLPA--GSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMP 446
            .|:.:|.:|| |||:.:..  |.:|.:.....||:...:.:|..||..|||.||.....||.:.|
  Fly   388 DRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDENKESIQPFTYFP 452

Human   447 FSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSR---LPIKM--PQLVLRSKNGFHLHL 503
            |..|.|||||.:||:.|.|.|....|..:.|:  |::   :|:::  ....|..|.||.:.|
  Fly   453 FGLGQRNCIGSRFALLEAKAVIYYLLKDYRFA--PAKKSCIPLELITSGFQLSPKGGFWIKL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 110/448 (25%)
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 110/448 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.