DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4B1 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:490 Identity:106/490 - (21%)
Similarity:187/490 - (38%) Gaps:74/490 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    50 PTHWLFGHALEIQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPK---- 110
            |..:|...|....:..|..|.:|..:.....|.|     :|..|:..|     :....||:    
  Fly    38 PYPFLGNMAASALQKASFQKQISEFYNRTRHHKL-----VGLFNLRTP-----MIQINDPQLIKK 92

Human   111 --APDVYDFF----------LQWIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRI 163
              ..| :|.|          .:.:...|.|:....|...|.:|||.|....::....:..||...
  Fly    93 ICVKD-FDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQ 156

Human   164 MLD--KWEEKAREGKS-----FDIFCDVGHMALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTL 221
            .|:  |..:....|::     ..:.|:  .::.:.:....||..........:..:.:.   .||
  Fly   157 CLEHLKSSQPIAAGENAFELDMKVLCN--KLSNDVIATTAFGLKVNSFDDPENEFHTIG---KTL 216

Human   222 LMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDF 286
            ...:.|...::   .:..|.|....|.:.......:.:..:|....|:|   .|:| .|....|.
  Fly   217 AFSRGLPFLKF---MMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQ---YREK-HNITRPDM 274

Human   287 LDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYP-----EHQHRCREEV 346
            :.:|:.|:.|.....:|.::.|:...|.|...:..::     |.|...|.     :.|.|..|||
  Fly   275 IQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNSN-----LICTTAYELLRNLDIQERLYEEV 334

Human   347 REILGDQDFFQ-----WDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVD--GRSL---P 401
            :|   .|:..:     :|...:|||:.|.|.||.|.:.......|..:|..|..|  |..|   .
  Fly   335 KE---TQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFK 396

Human   402 AGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKV 466
            ||..|::.|..||.:...:|.|:.||..|||........|:.::||..|||:|||.::|:.:.|.
  Fly   397 AGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKG 461

Human   467 VTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHL 501
            :....:|.::....|     :..:.:..|..||::
  Fly   462 MLYNLMLNYKIEASP-----RTTRDMWESARGFNI 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 106/488 (22%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 103/475 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.