DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4B1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:504 Identity:141/504 - (27%)
Similarity:247/504 - (49%) Gaps:70/504 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    15 LWAS--GLILVLGFLKLIHLLLRR-------QTLAKAMDKFPGPPTH---------WLFGHALEI 61
            :|.:  |..|::|.|   .||||:       .:|.|.:....|.|..         ..||:.|::
  Fly     1 MWIALLGSSLLIGAL---WLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDL 62

Human    62 QETGSLDKVVSWAHQFPYAHP----------LWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDV-Y 115
            ..       ::.|:.|.|...          :|...|....||...:.|:.::........:: |
  Fly    63 LN-------LTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSY 120

Human   116 DFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTR---IMLDKWEEKAREGKS 177
            :....::|.|||:....||...||.|||.||:::|:.::::|.|.::   .:|||     ..|..
  Fly   121 ELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDK-----NVGFE 180

Human   178 FDIFCDVGHMALNTLMKCTFGRGDTGLG-----HSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFI 237
            .::...:....||.:  |     :|.||     .|..:.|..|:.|..::..||:.:.....::.
  Fly   181 LELNQIIPQFTLNNI--C-----ETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWY 238

Human   238 YWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRK--KIQNRRHLDFLDILLGARDEDDIK 300
            ::|....:::.|..:..|..:..:|:.::...:.:::.:  :...::....||.||.|..|.  |
  Fly   239 FFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--K 301

Human   301 LSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQD---FFQWDDLG 362
            :....:..||:||||.|:|||::.:.:.|..:||:.:.|.||.||::::..|.|   .||:::| 
  Fly   302 IDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNEL- 365

Human   363 KMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFD 427
              .:|...||||.||:|..|.:.|...:. :.::|..||..:.||:|||.:.|::..:|.|..|.
  Fly   366 --IHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFL 427

Human   428 SLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFE 476
            ..||..||:..||||||:||||||||||||:|.:.|:||:.|..:..|:
  Fly   428 PERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 130/463 (28%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 128/451 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.