DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp6a17

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster


Alignment Length:538 Identity:134/538 - (24%)
Similarity:244/538 - (45%) Gaps:85/538 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    18 ILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRI-----QK 77
            :|..|.::::|.||:.|.: ..|..|..:.:   |....|.|||:|::....:.:..|     .|
  Fly     1 MLLLALIVVILSLLVFAAR-RRHGYWQRRGI---PHDEVHPLFGNIKDWPNKRHIAEIFRDYYFK 61

Human    78 WVET-FPSACPHWLWGGKVRVQLYDPDYMKVILGR--SDPKSHG-SYRFLAPWIGYGLLLLNGQT 138
            :..: :|.|...:.:.....|.  |.:.:|.:|.:  :..::.| .|..:...:...|..:.||.
  Fly    62 YKNSDYPFAGFFFFFTRTAVVT--DMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQK 124

Human   139 WFQHRRMLTPAFHYDILK---PYVGLMADSV-RVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMK 199
            |...|..|||.|....:|   |.|..:.:.: :|...|.....||  .|||...|:..|.|.|..
  Fly   125 WRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQ--VLEVVDLVARYTADVIGN 187

Human   200 CAFSHQGSIQVDRNSQSYI----QAISD------LNNLVFS--------RVRNAFHQNDTIYSLT 246
            |||....:...|..:: ::    :||::      |:..:|.        |::....:.:..|:  
  Fly   188 CAFGLNCNSLYDPKAE-FVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKLNIQEAEDFYT-- 249

Human   247 SAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILL-------LAKMENGS 304
                      ::..:..|..:              :.|.||: ||:|.|:       ....|:| 
  Fly   250 ----------KIVRETIDYRL--------------RTKEKRN-DFMDSLIEMYKNEQSGNSEDG- 288

Human   305 ILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLG-DGASITWNHLDQ 368
             |:..:|.|:...|...|.:|:::.:.:.||.||.:...|::.||||.::.| .....|:..:.:
  Fly   289 -LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKE 352

Human   369 MPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGR-SLPKGIMVLLSIYGLHHNPKVWPNPEVFD 432
            |.|....:.|.||.||.:..:.|...|..:..|.: .:.||.:|::...|:|::|.::|.||:|.
  Fly   353 MKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFK 417

Human   433 PFRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTL--LRFELLPDPTRIP--IPI 491
            |.||...  :|:.|..:|||..|.|||||.:|.|.:..|..|..:  .:|.:.|: |:||  |.:
  Fly   418 PERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPE-TQIPMKIVV 481

Human   492 ARLVLKSKNGIHLRLRRL 509
            ..:::.::|||||::.:|
  Fly   482 KNILISAENGIHLKVEKL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 124/498 (25%)
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 118/476 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.