DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:542 Identity:178/542 - (32%)
Similarity:290/542 - (53%) Gaps:57/542 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     4 SVLSPSRLLGDVSGILQAASLLILLLL---LIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQE 65
            |:::.|.||..|..::...|.:.:.||   ||..|.....|..|:|.:::.|.|.:....|:..|
  Fly     8 SLMAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIE 72

Human    66 LQQDQE--LQRI---QKWVETFPSACPHWLWGGKV-----------RVQLYDPDYMKVILGRSD- 113
            :..|.:  ..|:   ||            |||.::           ||.|::|:.::.||.... 
  Fly    73 MNVDHDELFNRVIGMQK------------LWGTRIGINRVWQGTAPRVLLFEPETVEPILNSQKF 125

Human   114 -PKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELL 177
             .||| .|.:|.||:|.|||....:.|...|::||||||:.||..::.:..:...|:..|....:
  Fly   126 VNKSH-DYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKLAVEV 189

Human   178 GQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQS-YIQAISDLNNLVFSRVRNAFHQNDT 241
            |.:: ..:|.:|:|.|||.:.:.|...:  |....||:| |::|:..:.::|.||....:.|:|.
  Fly   190 GSEA-FNLFPYVTLCTLDIVCETAMGRR--IYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDF 251

Human   242 IYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQ---LQKEGE---------LEKIKRKRHLDFLDI 294
            |:|||:..:.........|..::.||:.|||:   ||:...         .:.:.:|:.|.|||:
  Fly   252 IFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDL 316

Human   295 LLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDG- 358
            |:.|..| |::||::|:|.|||||||||||||::.|||.|:.|..||::|||..||:.|:.||. 
  Fly   317 LIDASKE-GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDK 380

Human   359 -ASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNP 422
             ...|..:|..|.|...|||::|||:|.||.:.|.:...|.. .|:.:|.|...::..|.||.||
  Fly   381 ETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNP 444

Human   423 KVWPNPEVFDPFRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPT 485
            :|:|.||.|:|..|.|.  :.:|..|::|||.|.|||||::||:.|.|...:..|.::::.....
  Fly   445 RVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDR 509

Human   486 RIPIP-IARLVLKSKNGIHLRL 506
            |..:. :..|:|:.|:|:.:::
  Fly   510 REDLTLLGELILRPKDGLRVKI 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 164/488 (34%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 164/489 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.