DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:525 Identity:127/525 - (24%)
Similarity:224/525 - (42%) Gaps:53/525 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    15 VSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRI-QKW 78
            |..:|..|.|.::..||:|......|.|.|     ..||...|.|.|.::.::..:....| ..:
  Fly     3 VGTVLLTALLALVGYLLMKWRSTMRHWQDL-----GIPCEEPHILMGSMKGVRTARSFNEIWTSY 62

Human    79 VETFPSACPH--WLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPW---IGYGLLLLNGQT 138
            ...|..:.|.  :.|..:..|.:.:....|.||.:...|......|..|.   :...|.||:||.
  Fly    63 YNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQK 127

Human   139 WFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD---SP-LEVFQHVSLMTLDTIMK 199
            |...|..|:..|....:|    .|..:|..:.:::.::.||:   || :||.:.::..|.|.|..
  Fly   128 WRTMRNKLSSTFTSGKMK----YMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGT 188

Human   200 CAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTD 264
            |||..:.|...|.:::........|.......|...|     :.|..:..|..|.      :.|.
  Fly   189 CAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGF-----VNSFPNLARRLHM------KMTA 242

Human   265 QVIQLRKAQLQKE----GELEKIKRKRHLDFLDIL-------LLAKMENGSI-LSDKDLRAEVDT 317
            :.|:....::.:|    .|...|:|.   ||:|.|       |:......|: |:.:::.|:...
  Fly   243 EPIERFFMRIVRETVAFREQNNIRRN---DFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFV 304

Human   318 FMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGD-GASITWNHLDQMPYTTMCIKEALR 381
            |...|.:|:::.:.:.||.||.:...|.|.|:|...::.. ...:.:..:..:.|....:.|.||
  Fly   305 FFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLR 369

Human   382 LYPPVPGIGRELSTPVTFPDGRS--LPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQH- 443
            ||..:|.:.||.......|....  :.||:.||:....:|.:.|::.||..|:|..|:|...:. 
  Fly   370 LYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKER 434

Human   444 -SHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL-LPDPTRIPIPIAR--LVLKSKNGIHL 504
             |..:|||..|.|||||.:|...:.::..||.:..|:. :.:.|.||:...:  .::.|.:||:|
  Fly   435 DSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYL 499

Human   505 RLRRL 509
            :..|:
  Fly   500 KAERV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 115/482 (24%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 115/481 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.