DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:536 Identity:146/536 - (27%)
Similarity:262/536 - (48%) Gaps:66/536 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQL-----YLHRQWLLKALQQF-------PC 53
            |.:::|..|.|:|.:..:|:..:....:|.|.|.|:.     ...:.:::....:|       ..
  Fly     1 MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNL 65

Human    54 PPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPK--- 115
            .|:: :|.:|:|              .|..:...:::|.     .|:.|:|.  |:...|.:   
  Fly    66 TPAN-IFSYIRE--------------STAKANGQNYIWN-----FLFAPEYN--IVRAEDAEEIF 108

Human   116 -------SHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKW 173
                   .:.||..:.|::|.|||:...|.|...|:.||||||::||:.::.:..:..:..:...
  Fly   109 QSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKIL 173

Human   174 EELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQ--SYIQAISDLNNLVFSRVRNAF 236
            ::.:|.:  ||:.|.:...||:.|.:.|.    .:::|..|:  .|.:||.|...:...|:.|..
  Fly   174 DKNVGFE--LELNQIIPQFTLNNICETAL----GVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPL 232

Human   237 HQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKE--GELEKIKRKRHLDFLDILLLAK 299
            ...:..:.|....:...|..:..|..:..:||.::.|.:::  |::::..:|:....||.||.|:
  Fly   233 MFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAE 297

Human   300 MENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWN 364
            .| |.| ..:.:..||:||||.|:|||::.:.:.|..||.|...||||.||:..|..|...::..
  Fly   298 AE-GKI-DHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMF 360

Human   365 HLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPE 429
            ..:::.:....|||:|||:|..|.||| .....:..:|..|||...:.:.||.:..:.:.:|.|.
  Fly   361 QFNELIHLECVIKESLRLFPSAPIIGR-TCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPN 424

Human   430 VFDPFRFAPGSA--QHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIA 492
            .|.|.||.|.::  :|..||:|||.|.|||||::|.:.|:||..|..:..|:||| .|::.    
  Fly   425 QFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP-ATQLE---- 484

Human   493 RLVLKSKNGIHLRLRR 508
              .|..:|||.||.::
  Fly   485 --DLTFENGIVLRTQQ 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 133/468 (28%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 136/486 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.