DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp4ac2

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster


Alignment Length:398 Identity:125/398 - (31%)
Similarity:211/398 - (53%) Gaps:24/398 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   120 YRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLE 184
            |..|.|::|.|||:...|.|...|:.||||||:.:|:.::.:..:....::....:.:..:  ||
  Fly   121 YELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKLVKVLHQSVNME--LE 183

Human   185 VFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQS--YIQAISDLNNLVFSRVRNAFHQNDTIYSLTS 247
            :.|.:...||:.:.:.|.    .:::|..|:.  |.|:|..:..::..|:.|.|..|...:.|..
  Fly   184 LNQVIPQFTLNNVCETAL----GVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLFG 244

Human   248 AGRWTHRACQLAHQHTDQVIQLRKA-----QLQKEGELEKIKRKRHLDFLDILLLAKMENGSILS 307
            ..|......::||:.:..:|:.|::     ||.:|.|..|.:|...||    .|||...:|.| .
  Fly   245 DYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLD----TLLAAEADGQI-D 304

Human   308 DKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYT 372
            .:.:..||:||||||:|||::.:.:.|..||.|...|::|.|||..|..|...|:....:::.|.
  Fly   305 HQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISVFQFNELVYM 369

Human   373 TMCIKEALRLYPPVPGIGRE-LSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRF 436
            ...|||:|||:|.||.|||. :...|.  :|..:||...:.:.:|.:..:.:.:.||::|.|.||
  Fly   370 ECVIKESLRLFPSVPFIGRRCVEEGVV--NGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRF 432

Human   437 APGSA--QHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIAR-LVLKS 498
            .|.:.  :|..||:|||.|.|||||::||:.|:||..|..:..|::||......:.... :||::
  Fly   433 FPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLDDLTFENGIVLRT 497

Human   499 KNGIHLRL 506
            |..|.::|
  Fly   498 KQNIKVKL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 124/395 (31%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 124/396 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.