DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:509 Identity:181/509 - (35%)
Similarity:274/509 - (53%) Gaps:43/509 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    22 ASLLILLLLLIKAVQLYLHRQWLLKALQQF----PCPPSHWLFGHIQELQQDQELQRIQKWVETF 82
            ::|.::..:|..|...||.:......||:|    |.|.       |.||..:.:...|..|::..
  Fly     2 STLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPT-------IGELIANVKKGEILNWLKEL 59

Human    83 PSACPHW----LWGGK-VRVQLYDPDYMKVILGRSD--PKSHGSYRFLAPWIGYGLLLLNGQTWF 140
            ..  .|.    :|.|| :.|...||:.:|.:||.:.  .||. :|..|.||:|.|||...|::|.
  Fly    60 RE--KHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSR-NYELLEPWLGKGLLTNGGESWH 121

Human   141 QHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQ 205
            :.|::|||.||:.||..:...|.::.|:::.:.......:| .:::.:::|..||.|.:.|...:
  Fly   122 RRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGES-FDIYPYITLFALDAICETAMGIK 185

Human   206 GSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLR 270
            ...|:..:|: |:||:..:..::..:..:.:.:.:..:..|..|:....|.::.|..|::||:||
  Fly   186 KHAQLQSDSE-YVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLR 249

Human   271 KAQL-------QKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTAS 328
            :.||       :.|.|.:.:..||.|.|||:|||.:||.|:.|||.|:|.|||||||||||||:|
  Fly   250 REQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSS 314

Human   329 GISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGREL 393
            .|::.|..|:.:|..|:|..||...|.|       ...:.|||....|||.||:||.||...|::
  Fly   315 AIAFALSLLSKNPDVQQRAFEEASELEG-------REKESMPYLEAVIKETLRIYPSVPFFSRKV 372

Human   394 STPVTFPDGR-SLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQ-HSHAFLPFSGGSRN 456
            ...:..  |: ::|||..:...||.||.:||.:|:||.|||.||.....| |..||..||.|.||
  Fly   373 LEDLEV--GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGPRN 435

Human   457 CIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRRLP 510
            |||::|||.|||.:.|:.|..:..|||....|.|:|.||.||.|||  |||.||
  Fly   436 CIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGI--RLRILP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 168/468 (36%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 159/454 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154676
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3155
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.600

Return to query results.
Submit another query.