DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp311a1

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster


Alignment Length:501 Identity:158/501 - (31%)
Similarity:253/501 - (50%) Gaps:53/501 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    29 LLLIKAVQLYLHRQW-LLKALQQFPCPPSHWLFGHIQ---ELQQD------QELQRIQKWVETFP 83
            ||||......|.|:| ||:.....|.|.:..|.|:.|   :|:.:      .||:  .::..|:.
  Fly     6 LLLITLTIWILVRKWTLLRLGSSLPGPWAFPLLGNAQMVGKLRPEYIFLVFTELR--DRFGATYR 68

Human    84 SACPHWLW-----GGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHR 143
            ......||     ..:.|..|:||...|.          .::..|.|.||.|||:.:|..|.:.|
  Fly    69 LRLGPQLWVFLHSAEETRQALHDPTLRKA----------DTFMQLEPLIGNGLLISHGAHWTRQR 123

Human   144 RMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLG-----QDSPLEVFQHVSLMTLDTIMKCAFS 203
            |:|||||...:|:.:...:...|       |.|:|     :.:.|||.:.:....||.|:..:..
  Fly   124 RLLTPAFQPQLLRSFAPAIGGHV-------ERLVGRLGATRGAFLEVTEPLFACLLDAIVDTSMG 181

Human   204 HQGSIQ-VDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVI 267
            .|...| ||.:  ..|||....:.|:|.|:.|....:|.|:..|...|......|:.|...:.||
  Fly   182 AQLDTQSVDHS--PIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQVIHSQMESVI 244

Human   268 QLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISW 332
            :.|..:|...||    ...|..:.||.|||||.| |..||.:::|.|::||:|.|.|||.:.:|:
  Fly   245 EKRAKELLDMGE----PAGRAHNLLDTLLLAKFE-GQSLSRREIRDEINTFVFAGVDTTTAAMSF 304

Human   333 ILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPV 397
            :|||||..|:.|.|.|:|:..:..| .:...:.|:.:||....|||.||||..||..||: :|..
  Fly   305 VLYALAKFPETQTRLRKELQDVALD-ETTDLDALNGLPYLEALIKEVLRLYTIVPTTGRQ-TTQS 367

Human   398 TFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAP---GSAQHSHAFLPFSGGSRNCIG 459
            |...||:...|:.:.:::|||.|:.:.:|:|..|.|.|:.|   ..|..:.:::|||||...|||
  Fly   368 TEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPEDGAVAPPAFSYIPFSGGPHVCIG 432

Human   460 KQFAMNELKVATALTLLRFELLPDPTRIPIPI-ARLVLKSKNGIHL 504
            :::::..:|:.||..:..|::...|.:.|:.: |::|||::.||::
  Fly   433 RRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQMVLKAQQGINV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 149/477 (31%)
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 149/477 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.