DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp4ae1

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster


Alignment Length:505 Identity:143/505 - (28%)
Similarity:253/505 - (50%) Gaps:36/505 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    24 LLILLLLLIKAVQLYLHR----------QWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKW 78
            :::|:.||:..:...|.|          |.::.::.:.|...:.|   .::..|.|....:..::
  Fly     3 VVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAAW---QMRSFQPDNLHDKFAEY 64

Human    79 VETFPSACPHWLWGGKVRVQLYDPDYMKVIL-GRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQH 142
            |:.|..:....:.|..|.|.. :|.::..:| |:...|....|..|..|:|.||||..|:.|...
  Fly    65 VKRFGRSFMGTVLGHVVMVTA-EPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLSRGKEWHTM 128

Human   143 RRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGS 207
            |:::||.||:.||:.:|.:......:::::...|...:..:.::..|.|..||.|.:.|.    .
  Fly   129 RKIITPTFHFSILEQFVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAALDIITETAM----G 189

Human   208 IQVDRN--SQSYIQAISDLNNLVFSRVRNAFHQNDTIYSL--TSAGRWTHRACQLAHQHTDQVIQ 268
            :.||..  ....:.|:.||.|::.:|..........::.|  .|..|.........|:.|:.:|:
  Fly   190 VNVDAQGADSEVVHAVKDLTNILATRFMRPHLLFPHLFRLCWPSGFRKQQAGVICLHEFTNGIIE 254

Human   269 LRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWI 333
            .|:..|.:|...:|..:...|  ||.||.|.:: |..|:||.:|.||:||:|||||||.|.:|:.
  Fly   255 QRRRLLAREANQDKPTKPHAL--LDTLLRATVD-GQPLTDKQIRDEVNTFIFEGHDTTTSAVSFC 316

Human   334 LYALATHPKHQERCREEIHSLLGDG--ASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTP 396
            ||.|:.|...|::..||:....|..  ..:..:....:||.:..:||:||||||:|.:.|.|...
  Fly   317 LYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPAVARCLEKD 381

Human   397 VTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRF----APGSAQHSHAFLPFSGGSRNC 457
            :...:| .:|.|..|::.::.|..:..::.:|.||.|.|.    ||..:.:|  ::|||.|.|||
  Fly   382 LVIDEG-YIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYS--YIPFSAGPRNC 443

Human   458 IGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLR 507
            ||::||:.|:|......:..::|||....:. |..::||:||:|:::.||
  Fly   444 IGQKFALLEMKTMVTKVIRHYQLLPMGADVE-PSIKIVLRSKSGVNVGLR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 135/463 (29%)
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 134/465 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.