DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp4d1

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster


Alignment Length:517 Identity:171/517 - (33%)
Similarity:290/517 - (56%) Gaps:36/517 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    15 VSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQEL---QQDQELQRIQ 76
            |.|.:.|::|.:.|||      .:|..:.|:..:...|.||...|.||....   ...:.:::|.
  Fly     4 VIGAILASALFVGLLL------YHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKKIF 62

Human    77 KWVETF--PSACPHWLWGGKVRVQLYDPDYMKVILG--RSDPKSHGSYRFLAPWIGYGLLLLNGQ 137
            :::||:  ......|| |.::.|.:.:|..::|:||  |.:.|: |.|:.|.||:..|||:..|:
  Fly    63 EFMETYSKDQVLKVWL-GPELNVLMGNPKDVEVVLGTLRFNDKA-GEYKALEPWLKEGLLVSRGR 125

Human   138 TWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEE--LLGQDSPLEVFQHVSLMTLDTIMKC 200
            .|.:.|:::|||||:.||..:|.:.....|.:|...|:  |...||...::..::|.|:|||  |
  Fly   126 KWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWINLCTMDTI--C 188

Human   201 AFSHQGSIQVDRNSQS-YIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTD 264
            ..:...||....|:.| |:||:..::.::..|:.|..::.|..|.||...|...:|..:.||.|:
  Fly   189 ETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLHQFTE 253

Human   265 QVIQLRKAQLQKEGELEK-------IKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEG 322
            ::|..|:.:|.:||..::       :..||.:.||||||.:.::... ||:.|:|.|||||||||
  Fly   254 KIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERP-LSNLDIREEVDTFMFEG 317

Human   323 HDTTASGISWILYALATHPKHQERCREEIHSLLGDGAS--ITWNHLDQMPYTTMCIKEALRLYPP 385
            ||||:|.:.:..|.:||||:.|::|.|||.|::|:..|  :::..|:|:.|..:|:||.||:||.
  Fly   318 HDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPS 382

Human   386 VPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRF---APGSAQHSHAF 447
            ||.:||::...... :|:.:|.|..:.:|...|....:::..|.:|.|.||   ......:.:|:
  Fly   383 VPLLGRKVLEDCEI-NGKLIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVVTTAEKLNPYAY 446

Human   448 LPFSGGSRNCIGKQFAMNELKVATALTLLRFEL--LPDPTRIPIPIARLVLKSKNGIHLRLR 507
            :|||.|.|||||::|||.|:|...|..|..:|:  :.|.:..|:.||.|:|::|..:..::|
  Fly   447 IPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKEPLMFKVR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 161/476 (34%)
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 161/477 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154738
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.