DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4A11 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:557 Identity:161/557 - (28%)
Similarity:257/557 - (46%) Gaps:75/557 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     2 SVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWL-----LKALQQFPCPPSHWLFG 61
            |.:||..|.:|..:.|.|               |.:.|:..|.     .:.:...|.||...:.|
  Fly    18 STTVLGFSPMLTTLVGTL---------------VAMALYEYWRRNSREYRMVANIPSPPELPILG 67

Human    62 --HIQELQQDQE-----LQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVIL-GRSDPKSHG 118
              |:.....:.|     |..:.|:.||..:    || |..:.|.|.:|..:::|| |........
  Fly    68 QAHVAAGLSNAEILAVGLGYLNKYGETMKA----WL-GNVLLVFLTNPSDIELILSGHQHLTKAE 127

Human   119 SYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPL 183
            .||:..||.|.|||:.||..|..||:|:.|.||..|||.:|....|..:.::.:.....|:.  .
  Fly   128 EYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGKS--F 190

Human   184 EVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSA 248
            :|..::|..|:|.::..|...: .:.....|..|.||:.|:.:::..|.....::.|:||..|..
  Fly   191 DVHDYMSQTTVDILLSTAMGVK-KLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKL 254

Human   249 GRWTHRACQLAHQHTDQVIQLRKAQLQ---------------------KEG---ELEKIKR---- 285
            .....|...:....|.:|::.||...|                     |||   :|:.|..    
  Fly   255 REKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVG 319

Human   286 -KRHLDFLDILL-LAKMENGSI-LSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERC 347
             ||.|..||.:: :||  |..| .::||:..||:|.||||||||::|.|:.|..:..|...|.:.
  Fly   320 AKRRLALLDAMVEMAK--NPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKV 382

Human   348 REEIHSLLGDG--ASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDG-RSLPKGI 409
            ..|..::.||.  ...|:....:|.|....|.|.||||||||.|.|.|...:....| .::|||.
  Fly   383 FAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGT 447

Human   410 MVLLSIYGLHHNPKVWPNPEVFDPFRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATA 472
            .|::..|.:|..|.::|||..|||..|.|.  :.:|.::|:|||.|.|:|:|:::||.:|||..:
  Fly   448 TVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLS 512

Human   473 LTLLRFELLPDPTRIPIPI-ARLVLKSKNGIHLRLRR 508
            ..:..:.:....|.....: |.::||.:||.::.|.:
  Fly   513 TIVRNYIVHSTDTEADFKLQADIILKLENGFNVSLEK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4A11NP_000769.2 p450 52..505 CDD:278495 150/497 (30%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 144/469 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.