DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKX6-3 and HGTX

DIOPT Version :9

Sequence 1:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens
Sequence 2:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster


Alignment Length:287 Identity:108/287 - (37%)
Similarity:134/287 - (46%) Gaps:71/287 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MESNLQGTFLLNNTPLAQF----PEMK----------APVCQYSVQNSFYKLSPPGLGPQLA--- 48
            |:..|..:||  ..|||..    .|||          |....||...:.:.:|..|.|...:   
  Fly   284 MDHKLPLSFL--GPPLAALHSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSS 346

Human    49 ----------AGTPHGITDILSR--PVAAPNNSLLSG-----YPHVAGFGGLS-----SQGVYYS 91
                      |..||||..|||:  ||.:...|.|:|     :...|...|::     |||....
  Fly   347 TTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLK 411

Human    92 PQVGNFSKAGNEYPTRTRNCWADTGQD--------WRGGRQCSNTPD----------PLSDSIHK 138
            ...|:.       ..||...|  .|..        ||  .:.|||..          |.:|...|
  Fly   412 THAGHI-------VDRTHLYW--PGLQGLVANPIAWR--ERLSNTMSANLSQSHQHHPSNDKDGK 465

Human   139 KKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPS 203
            ||||||||:|.|||||||||||||||||||||:|||:|||:|||||||||||||||||:.|.| .
  Fly   466 KKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAE-M 529

Human   204 SSTPRAPGGAGAGAGGDRAPSENEDDE 230
            ::..|.....|....||.:.:.:.|:|
  Fly   530 ATAKRKQDDMGGDNDGDCSETMDSDNE 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 47/52 (90%)
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 29/105 (28%)
Homeobox 469..523 CDD:395001 48/53 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5911
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001882
OrthoInspector 1 1.000 - - otm42262
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4964
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.