DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKX6-3 and cog-1

DIOPT Version :10

Sequence 1:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens
Sequence 2:NP_001022264.1 Gene:cog-1 / 175149 WormBaseID:WBGene00000584 Length:256 Species:Caenorhabditis elegans


Alignment Length:86 Identity:53/86 - (61%)
Similarity:65/86 - (75%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   138 KKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEP 202
            :||.:|||||||||:.||:.|||||||||.:||:||..|.|:||||||||||||||||||.|.: 
 Worm   168 QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAAD- 231

Human   203 SSSTPRAPGGAGAGAGGDRAP 223
            ::...|       ||.||::|
 Worm   232 NALVKR-------GASGDKSP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKX6-3NP_001351770.1 Homeodomain 138..196 CDD:459649 43/57 (75%)
cog-1NP_001022264.1 Homeodomain 170..226 CDD:459649 42/55 (76%)

Return to query results.
Submit another query.