DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A5 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_000768.1 Gene:CYP3A5 / 1577 HGNCID:2638 Length:502 Species:Homo sapiens
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:519 Identity:168/519 - (32%)
Similarity:266/519 - (51%) Gaps:60/519 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    13 LLLAVSLVL---LYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYR-----QGLWKFDTECYKKY- 68
            :|||:.:||   |.|...|....::.|.||...|..|:|::...:     ..:|   .:.|.|: 
  Fly     6 VLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAIW---MDYYNKFR 67

Human    69 --GKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGF--------MKSAISLAED 123
              |...|.|..|.|.:.:.|..:.:.:|:|| ::.||:|      ||        :...:.|.:.
  Fly    68 GTGPFAGFYWFQRPGILVLDISLAKLILIKE-FNKFTDR------GFYHNTEDDPLSGQLFLLDG 125

Human   124 EEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTS 188
            ::||.:||.||.||||||:|.|||.:.:.|...:....:..||...|.::||...::.|||...:
  Fly   126 QKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTDVIGTCA 190

Human   189 FGVNIDSLNNPQDPFVESTKKFL---KFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLS 250
            ||:...||.:|:..|....::.:   :.|.:...|::         .|:.|...|..|.|:....
  Fly   191 FGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFIN---------SFQNLARRLHMKITLEEAE 246

Human   251 KSVNRMKKSRLNDKQKH---RLDFLQLMIDSQNSKETESHKA----LSDLELAAQSIIFIFAGYE 308
            ....|:.:..:..::|:   |.||:..:||.:||..|:|...    |:..|:|||:.:|..||:|
  Fly   247 HFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFE 311

Human   309 TTSSVLSFTLYELATHPDVQQKLQKEIDAVLPN-KAPPTYDAVVQMEYLDMVVNETLRLFPVAIR 372
            |:|:.:.|.|||||.|.|:|.:::||...|:.. ....||:::..|.|||.|::|||||:.|...
  Fly   312 TSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPV 376

Human   373 LERTCKKDVEING---VFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS----KKKDSIDPYI 430
            |.|.|.:|.|:.|   ..|.||..|:||..|:|.|.|.:..|..|.|:.||    |::||::   
  Fly   377 LNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVE--- 438

Human   431 YTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG-LLQPEKPIVLKVD 493
            :.|||.||||||||||..|..:..|..::..|.|..|::|.||:....:. |:..|..|.|||:
  Fly   439 WLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKVE 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A5NP_000768.1 p450 39..492 CDD:365848 156/487 (32%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 155/485 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8447
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.