DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A5 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_000768.1 Gene:CYP3A5 / 1577 HGNCID:2638 Length:502 Species:Homo sapiens
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:512 Identity:145/512 - (28%)
Similarity:236/512 - (46%) Gaps:53/512 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    12 WLLLAVSLVLLYLYGTRTHGLFKRLGIP-----GPTPLPLLGNVLSYRQGLWKFDTECY----KK 67
            |||| :::|.|..:....:..|:..|||     ..:|:..||.:|..|........:.|    ..
  Fly     5 WLLL-LTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRNG 68

Human    68 YGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAIS--LAEDEEWKRIR 130
            ..|:.|.:..|.|.|.:.||::||.||:|. ::.|.||......|....|::  ||:...||..|
  Fly    69 QAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132

Human   131 SLLSPTFTSGKLK-----EMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFG 190
            ..:|..||||:::     :|..:.:.....|.|.|....|:..|  |..:...|:.||.....:.
  Fly   133 QCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLP--LGRMCQLYTTDVTGNLFYS 195

Human   191 VNIDSLNNPQDPFVESTKKFLKFG---FLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKS 252
            :|:..|...:...:..||:.....   .||  |:|:...|..|.|   |...:|.:|...::...
  Fly   196 LNVGGLRRGRSELITKTKELFNTNPRKVLD--FMSVFFLPKWTGV---LKPKVFTEDYARYMRHL 255

Human   253 VN----RMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSV 313
            |:    ..|...:|..|..:|        |::|.....|...    :|:|:.|.:.||:||:|::
  Fly   256 VDDHHEPTKGDLINQLQHFQL--------SRSSNHYSQHPDF----VASQAGIILLAGFETSSAL 308

Human   314 LSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCK 378
            :.|||||||..||:|::|:.|:.....:.|..:||.::.:.||.||..|.|||:|.|..:.|.|.
  Fly   309 MGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECT 373

Human   379 KDVEIN-------GVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKD-SIDPYIYTPFG 435
            ......       ...:|.|....|....||.|.::|.||..|.||||..::. .|.|..|.|||
  Fly   374 SSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFG 438

Human   436 TGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG-LLQPEKPIVLK 491
            .||..|||.|..::.:||.::.:|:.:..:.|:.|...::.:.:. :|:.|..|.|:
  Fly   439 AGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A5NP_000768.1 p450 39..492 CDD:365848 136/485 (28%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 131/471 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.