DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A5 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_000768.1 Gene:CYP3A5 / 1577 HGNCID:2638 Length:502 Species:Homo sapiens
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:517 Identity:176/517 - (34%)
Similarity:270/517 - (52%) Gaps:47/517 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    11 TWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWK------FDTECYKKY- 68
            |..|:.|.|.|.|....:....:||.|:|..||||::||:    :|:.|      .:...|||: 
  Fly     4 TIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNM----RGIVKKYHFRDINQRIYKKFK 64

Human    69 --GKMWGTYEGQLPVLAITDPDVIRTVLVKE-CY----SVFTNRRSLGPVGFMKSAISLAEDEEW 126
              |.:.|.|........|||.|.|:.|::|: .|    ..|||.|.....|.:.:    .|.|||
  Fly    65 GQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFA----LEGEEW 125

Human   127 KRIRSLLSPTFTSGKLKEMFPIIA----QYGDVLVRNLRR-EAEKGKPVTLKDIFGAYSMDVITG 186
            :.:|..|:|.|||||:|:|..:|.    :.||.:.:.::. :.|:|. |.:||:...::.|||..
  Fly   126 RAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGN-VEIKDLCARFTTDVIGS 189

Human   187 TSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSK 251
            .:||:..:||.:|...|.:..::.........|..|.|...  ..:...|.:.:.|.|...|...
  Fly   190 CAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTN--ARLARKLRIKVLPDDLTQFFMS 252

Human   252 SVNRMKKSRLNDKQKHRLDFLQLMI-----DSQNSKETE----SHKALSDLELAAQSIIFIFAGY 307
            :|......||.:..| |.||::.||     |.:.:|:.:    || .|:..::|||:.:|..||:
  Fly   253 TVKNTVDYRLKNGIK-RNDFIEQMIELRAEDQEAAKKGQGIDLSH-GLTLEQMAAQAFVFFVAGF 315

Human   308 ETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPN--KAPPTYDAVVQMEYLDMVVNETLRLFPVA 370
            ||:||.:|..|||||..||:||:|::||::||.|  .....||.:.||.|||.|::||||..|:.
  Fly   316 ETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLL 380

Human   371 IRLERTCKKDVEI--NGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKK-DSIDPYIYT 432
            ..|.|...||.:|  :.:.:.||.:.:||.:.:||||:.:.|||:|.|.||..:: .:..|..|.
  Fly   381 PHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKNRHPMAYL 445

Human   433 PFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG-LLQPEKPIVLKVD 493
            |||.|||||||:||..:..|:.|:.:|:.|.|.....|.:||....:. ||.....|.|||:
  Fly   446 PFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSFLLTTNDGIYLKVE 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A5NP_000768.1 p450 39..492 CDD:365848 165/486 (34%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 165/486 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8447
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.