DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A5 and Cyp4d2

DIOPT Version :9

Sequence 1:NP_000768.1 Gene:CYP3A5 / 1577 HGNCID:2638 Length:502 Species:Homo sapiens
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster


Alignment Length:485 Identity:149/485 - (30%)
Similarity:250/485 - (51%) Gaps:50/485 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    13 LLLAVSLVLL--YLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYR----QGLWKFDTECYKKYGKM 71
            ||:|.:.:||  :|:..|.:|:     :|||.|||.|||:|.||    :.:..|..:..:|||::
  Fly     9 LLVAFATLLLWDFLWRRRGNGI-----LPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRKYGRL 68

Human    72 WGTY-EGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSP 135
            :..: ..||.|.: |||..|..||..:.:....|...|... ::...:.::...:|...|.:::|
  Fly    69 YRVWILHQLAVFS-TDPRDIEFVLSSQQHITKNNLYKLLNC-WLGDGLLMSTGRKWHGRRKIITP 131

Human   136 TFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQ 200
            ||....|::...|..|...|:|..|:..|:...|:.:..:....::|:|..|:.|..|::..||.
  Fly   132 TFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTKINAQKNPN 196

Human   201 DPFVEST--------KKFL-KFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRM 256
            .|:|::.        |:|: .:..:|.:|.       ||...||.......|...:|....:...
  Fly   197 LPYVQAVNDVTNILIKRFIHAWQRVDWIFR-------LTQPTEAKRQDKAIKVMHDFTENIIRER 254

Human   257 KKSRLNDK-------------QKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYE 308
            :::.:|:.             ||.|:..|.:::.|     |.....|||.::..:...|:|.|::
  Fly   255 RETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQS-----TIDGAPLSDEDIREEVDTFMFEGHD 314

Human   309 TTSSVLSFTLYELATHPDVQQKLQKEIDAVL--PNKAPPTYDAVVQMEYLDMVVNETLRLFPVAI 371
            ||:|.:||.|||::.||:|||:||:||..||  ..|:|.|...:.::::::.|:.|:|||.|...
  Fly   315 TTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVP 379

Human   372 RLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGT 436
            .:.|...:||||.|..||.|:...:..:.|..||:|:..|:|||||||......|.||.|.||..
  Fly   380 MIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHPYAYIPFSA 444

Human   437 GPRNCIGMRFALMNMKLALIRVLQNFSFKP 466
            |||||||.:||::.||..:.::|::|...|
  Fly   445 GPRNCIGQKFAMLEMKSTVSKLLRHFELLP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A5NP_000768.1 p450 39..492 CDD:365848 141/457 (31%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 141/457 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.