DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:505 Identity:152/505 - (30%)
Similarity:259/505 - (51%) Gaps:71/505 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    11 TWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVW--- 72
            |.||..|..:|:....|..|  ::.||||...|...:|::    ||     :...:.:.::|   
  Fly     9 TALLALVGYLLMKWRSTMRH--WQDLGIPCEEPHILMGSM----KG-----VRTARSFNEIWTSY 62

Human    73 -----------GFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGF--------MKSAI 118
                       |||..::|.:.:.:..:.|.:|:|| ::.||:|      ||        :...:
  Fly    63 YNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKE-FNKFTDR------GFFHNPEDDPLSGQL 120

Human   119 SIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIA----QYGDVLVRNLRREAETGKPVT-LKDVFGA 178
            .:.:.::|:.:|:.||.||||||:|.|.|.:.    ::.||..:|:.:     .||. ::::...
  Fly   121 FLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAK-----SPVVEVRELLAR 180

Human   179 YSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLS-ITVFPFLIPILEVLNICVFP 242
            ::.|||.:.:||:...||.:|...|.|..::.|....|.|..:. :..||.|   ...|::.:..
  Fly   181 FTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNL---ARRLHMKMTA 242

Human   243 REVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN-----SKETESHKALSDLELVAQSIIF 302
            ..:..|..:.|:.....| |.....|.||:..:||.:|     |:..||.. |:..|:.||:.:|
  Fly   243 EPIERFFMRIVRETVAFR-EQNNIRRNDFMDQLIDLKNKPLMVSQSGESVN-LTIEEIAAQAFVF 305

Human   303 IFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN-KAPPTYDTVLQMEYLDMVVNETLRL 366
            ..||:||:|:.:.|.:||||.:.|:|.::::|...|:.. .....|:::..:.|||.||:|||||
  Fly   306 FAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRL 370

Human   367 FPIAMRLERVCKKDVEING---MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSK---KNKD 425
            :.:...|.|.|.:|.|:.|   ..|.||:.|:||..|:|||.|.:..|..|.|:.||.   |.:|
  Fly   371 YTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERD 435

Human   426 NIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPL 475
            :::   :.|||.||||||||||..|..::.|..::::|.|..|::|.||:
  Fly   436 SVE---WLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPM 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:365848 142/477 (30%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 142/477 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.