DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:511 Identity:141/511 - (27%)
Similarity:243/511 - (47%) Gaps:50/511 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    12 WLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPF--LGNI-------LSYHKGFCMFDMECHKK 67
            |||| :::|.|..:..|.:..|:..|||...|..:  :||:       :|:...|.....:....
  Fly     5 WLLL-LTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRNG 68

Human    68 YGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAIS--IAEDEEWKRLR 130
            ..|:.||:..|.|.|.:.||::|:.||:|. ::.|.||......|....|::  :|:...||..|
  Fly    69 QAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132

Human   131 SLLSPTFTSGKLK-----EMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFG 190
            ..:|..||||:::     :|:.:.:.....|.|.|....|...|  |..:...|:.||..:..:.
  Fly   133 QCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLP--LGRMCQLYTTDVTGNLFYS 195

Human   191 VNIDSLNNPQDPFVENTKKLLR------FDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFL 249
            :|:..|...:...:..||:|..      .||:..|||     |....:|:       |:..|...
  Fly   196 LNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFL-----PKWTGVLK-------PKVFTEDY 248

Human   250 RKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVL 314
            .:.::.:.:...|.|:...::.||....|::|.....|...    :.:|:.|.:.||:||:|:::
  Fly   249 ARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDF----VASQAGIILLAGFETSSALM 309

Human   315 SFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKK 379
            .|.:||||..||:|::|:.|:.....:.|..:|||::.:.||.||..|.|||:|.|..:.|.|..
  Fly   310 GFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374

Human   380 DVEIN-------GMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGS 437
            .....       ...:|.|:...|....||||.::|.||..|.||||..:...:|.|..|.|||:
  Fly   375 SASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439

Human   438 GPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLS-LGGLLQPEKPVVLK 492
            ||..|||.|..::.:||.::.:|:.:..:.|:.|...::.: ...:|:.|..:.|:
  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:365848 131/484 (27%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 127/470 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.