DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:518 Identity:180/518 - (34%)
Similarity:274/518 - (52%) Gaps:48/518 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    11 TWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGN----ILSYHKGFCMFDMECHKKY--- 68
            |..|:.|.|.|.|.........:|:.|:|..||||.:||    :..||  |...:...:||:   
  Fly     4 TIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKYH--FRDINQRIYKKFKGQ 66

Human    69 GKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF-----GPVGFMKSAISIAEDEEWKR 128
            |.:.|.|...:....|||.|.||.|::|: :|.|.:|..|     .|   :...:...|.|||:.
  Fly    67 GPIAGMYMFFKRTALITDLDFIKQVMIKD-FSYFQDRGAFTNPRDDP---LTGHLFALEGEEWRA 127

Human   129 LRSLLSPTFTSGKLKEMVPIIA----QYGDVLVRNLRR-EAETGKPVTLKDVFGAYSMDVITSTS 188
            :|..|:|.|||||:|:|..:|.    :.||.:.:.::. :.|.|. |.:||:...::.|||.|.:
  Fly   128 MRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGN-VEIKDLCARFTTDVIGSCA 191

Human   189 FGVNIDSLNNPQDPFVENTKKLL---RFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLR 250
            ||:..:||.:|...|.:..:::.   |...|...|:....     .:...|.|.|.|.::|.|..
  Fly   192 FGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNA-----RLARKLRIKVLPDDLTQFFM 251

Human   251 KSVKRMKESRLEDTQKHRVDFLQLMI-----DSQNSKETE----SHKALSDLELVAQSIIFIFAG 306
            .:||...:.||::..| |.||::.||     |.:.:|:.:    || .|:..::.||:.:|..||
  Fly   252 STVKNTVDYRLKNGIK-RNDFIEQMIELRAEDQEAAKKGQGIDLSH-GLTLEQMAAQAFVFFVAG 314

Human   307 YETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN--KAPPTYDTVLQMEYLDMVVNETLRLFPI 369
            :||:||.:|..:||||..||:||:|:|||::||.|  .....||.:.||.|||.|::||||..|:
  Fly   315 FETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPL 379

Human   370 AMRLERVCKKDVEI--NGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIY 432
            ...|.|...||.:|  :.:.:.||::.:||.:.:|.||:.:.|||||.|.||..:...|..|..|
  Fly   380 LPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKNRHPMAY 444

Human   433 TPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGG-LLQPEKPVVLKVE 494
            .|||.|||||||:||..:..|:.|:.:|:.|.|.....|.:||..|... ||.....:.||||
  Fly   445 LPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSFLLTTNDGIYLKVE 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:365848 169/487 (35%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 169/487 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8447
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.