DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4e3

DIOPT Version :9

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster


Alignment Length:543 Identity:137/543 - (25%)
Similarity:246/543 - (45%) Gaps:84/543 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    12 WL----LLAVSLVLLYLY---GTHSHGLFKKLGIPGPTPLPFLGN----------ILSYHKGFCM 59
            ||    ||.:.|:.|..:   .:....|.|:..  ||||:|.|||          |||     ..
  Fly     2 WLAVLALLVLPLITLVYFERKASQRRQLLKEFN--GPTPVPILGNANRIGKNPAEILS-----TF 59

Human    60 FDMECHKKYGK-VWGFYDGQQPVLAITDPDMIKTVL----VKECYSVFTNRRPFGPVGFMKSAIS 119
            ||.  ...||| .:.|:.|....:.:|:|..::.:|    :.:..:::....|:...|.:.|..|
  Fly    60 FDW--WYDYGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFGS 122

Human   120 IAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVI 184
                 :|.:.|.:::|:|....|::...::.:.....:..|::.:.....:..::.....::|||
  Fly   123 -----KWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVI 182

Human   185 TSTSFGVNIDSLNNPQDPFVENTKKL---LRFDFLDPFFLSITVFPFLIP-------ILEVLNIC 239
            ..|:.||.|:::.......|:..:.:   :......||..|..||. |.|       .|:.|...
  Fly   183 CDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFS-LTPEFSAYQKTLKTLQDF 246

Human   240 VFPREVTNFLRKSVKRM-----KESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQS 299
            .:     :.:.|.|..:     ||.......:.::.||..::.|     |...:.|:..|:..:.
  Fly   247 TY-----DIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSS-----TIDGRPLTRQEIYEEV 301

Human   300 IIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN--KAPPTYDTVLQMEYLDMVVNE 362
            ..|:|.|::||:|.:||.:|.|:.|||||:||..|...|:.:  ....::..:.:|:|||:.:.|
  Fly   302 STFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKE 366

Human   363 TLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNI 427
            ..|::|....:.|.|.||.:|||..:|||..:.:....|..:.:.:.:|..|.||||.::..   
  Fly   367 AQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKP--- 428

Human   428 DPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG---GLLQPEK-- 487
            .|:.|.||.:|||||||.:|||:.:|..:.:|:::|...|..:..:.....|.   ||...||  
  Fly   429 APFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLK 493

Human   488 ---------PV---VLKVESRDG 498
                     |:   ||.::|.:|
  Fly   494 REAGRHKYDPILSAVLTLKSDNG 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:365848 127/502 (25%)
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 118/458 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.