DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp28d1

DIOPT Version :9

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster


Alignment Length:495 Identity:136/495 - (27%)
Similarity:238/495 - (48%) Gaps:64/495 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    14 LLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSY--HKGFCMFDM----ECHKKYGKVW 72
            ::|..|.|:|::.|.:...:||.|||.....||:|:..|.  .|...::|:    |.:|....:.
  Fly    10 VIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIYEQYKNTDSIV 74

Human    73 GFYDGQQPVLAITDPDMIKTVLVKECYSVFTN---------------RRPFGPVGFMKSAISIAE 122
            |.:..:.|.|.:|.|:....:.|.:..|...|               ..||           :..
  Fly    75 GVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNPF-----------VLT 128

Human   123 DEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREA--ETGKPVTLKDVFGAYSMDVIT 185
            .|.||..|:.::|..::.::|...|:..:.....|..:||::  ...:.:..||:...|:.:||:
  Fly   129 GEAWKERRAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVIS 193

Human   186 STSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSI-TVFPFLIPILEVLNICVFPREVTNF- 248
            ....|::..|..:...|.|..||::....|...|:..: .::|   ||.:..::.:|.::|..| 
  Fly   194 DCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVANLWP---PITKFYSVSLFAKDVAAFF 255

Human   249 ---LRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETT 310
               ::|.::..:||   ...:.|.|||..|:..|..      |.|:..||.:.::.|:..|:|||
  Fly   256 YDLMQKCIQVRRES---PAAQQRDDFLNYMLQLQEK------KGLNAAELTSHTMTFLTDGFETT 311

Human   311 SSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLER 375
            :.||:..:..||.:|..|.||:|||     ..|..|::.:.::.:.:..::||||:|...:...:
  Fly   312 AQVLTHTLLFLARNPKEQMKLREEI-----GTAELTFEQISELPFTEACIHETLRIFSPVLAARK 371

Human   376 VCKKDVEI---NGMFIP--KGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKN---KDNIDPYIY 432
            |..:..|:   ||:.:.  .|.||:||..|||.||:|:.||:.|.||||...|   |...|..::
  Fly   372 VVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGAKKYRDQGLF 436

Human   433 TPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQ 472
            ..||.|||.|.||||:|..:|.||:.:::||..|...:|:
  Fly   437 FGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTR 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:365848 127/470 (27%)
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 127/470 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.