DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:465 Identity:133/465 - (28%)
Similarity:223/465 - (47%) Gaps:63/465 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    38 IPGPTPLPFL-----GNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKE 97
            :||||....:     |.||::.|       |..:|:|.|:..:.|:..::..|||:.||.:|...
  Fly    35 LPGPTIGELIANVKKGEILNWLK-------ELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNN 92

Human    98 CYSVFTNRR------PFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVL 156
              .:.|..|      |:...|.:.:.     .|.|.|.|.||:|.|....|.|....:.:...:|
  Fly    93 --QLLTKSRNYELLEPWLGKGLLTNG-----GESWHRRRKLLTPGFHFRILSEFKEPMEENCRIL 150

Human   157 VRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLR------FDF 215
            ||.||.:| .|:...:......:::|.|..|:.|:...:.......:|:..:.:.|      |.|
  Fly   151 VRRLRTKA-NGESFDIYPYITLFALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSF 214

Human   216 ---LDPFFLSITVFPFLIPILEVLNICVFPREVTN---FLRKS--VKRMKESRLEDTQ-----KH 267
               |:.||............|:||:      :.||   .||:.  ::...|.:.|..|     |.
  Fly   215 WQRLNVFFKHTKPGKEREAALKVLH------DETNRVIRLRREQLIQERNEWKPEAEQDDVGAKR 273

Human   268 RVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQ 332
            |:.||.:::.:|    .|....|||.::..:...|:|.|::||||.::|.:..|:.:|||||:..
  Fly   274 RLAFLDMLLLTQ----MEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAF 334

Human   333 EEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIP 397
            ||...:...:..       .|.||:.|:.||||::|......|...:|:|:..:.:|||..:...
  Fly   335 EEASELEGREKE-------SMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCL 392

Human   398 SYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQN 462
            .|.||||||.:.:||:|.|:|| ..|:..:.|:.:..|.:|||||||.:||::.:|.:|..:|::
  Fly   393 IYMLHRDPKNFPDPERFDPDRF-LVNEKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRS 456

Human   463 FSFKPCKETQ 472
            :.|.|.|:.|
  Fly   457 YRFLPDKDHQ 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:365848 133/464 (29%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 133/465 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.