DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Runx3 and RunxA

DIOPT Version :9

Sequence 1:NP_569109.1 Gene:Runx3 / 156726 RGDID:620082 Length:409 Species:Rattus norvegicus
Sequence 2:NP_001259747.1 Gene:RunxA / 4379817 FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster


Alignment Length:394 Identity:153/394 - (38%)
Similarity:190/394 - (48%) Gaps:88/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    54 RSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENY 118
            |::.|.|.:|.|||:||.||.|:|:|||.|||.|||||||||||:|||:.|||:|||.|||||||
  Fly    86 RTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENY 150

  Rat   119 SAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR- 182
            .|||||.:||||||||:||||||||||||||||||||||.|||..:|||::||||||||||||| 
  Fly   151 CAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRS 215

  Rat   183 RHRQKIEDQTKAFPDRFGDLRMRVTPSTPSPRGSLSTTSHFSSQAQTPIQGSSD-LNPFSDPRQF 246
            :....:..|.:.|...||                           |.|...|:| |:.|..|   
  Fly   216 KTMLSLLGQQQQFHFAFG---------------------------QRPFHFSTDPLSGFRMP--- 250

  Rat   247 DRSFPTLQSLTESRFPEGRMHYPGAMSAAFPYSATPSGTSLGGLSVAGMPASSRFHHTYLPPPYP 311
              .....||.:.:.:     .|..|.||..||.|:      .|||....|.|::|::..|.....
  Fly   251 --PIGNCQSASNTHW-----GYGSAASAYSPYLAS------SGLSSCTTPTSAQFNNPALGFTCS 302

  Rat   312 GAPQSQSGPF---------------QANPAPYHL--FYGTSSGSYQFSMAAAGGGERSPTRMLTS 359
            ...||.:..|               .|:....||  ..|::||..........||:.|.:..:..
  Fly   303 SNDQSNNQDFGGATNRDCVPMLPDSTASDLDQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNG 367

  Rat   360 CPTGASVSAGNLMNPSLGQADGVEADG-----------------------SHSNSPTALSTPGRM 401
            ...|.|..||....   |...|..|.|                       |..|.|.:||...:.
  Fly   368 ASGGGSAGAGTAGG---GAGSGGGAGGGAGGNSILVPRYHTNASNEYNVHSSQNGPRSLSDSSQA 429

  Rat   402 DEAV 405
            :..|
  Fly   430 ESPV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Runx3NP_569109.1 Runt 63..184 CDD:279225 97/121 (80%)
RunxI 314..409 CDD:285676 26/132 (20%)
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/120 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2685
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8944
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X738
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.