DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP2C18 and spo

DIOPT Version :9

Sequence 1:NP_000763.1 Gene:CYP2C18 / 1562 HGNCID:2620 Length:490 Species:Homo sapiens
Sequence 2:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster


Alignment Length:502 Identity:139/502 - (27%)
Similarity:226/502 - (45%) Gaps:100/502 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    32 GPTPLPIIGNILQLD-VKDMS-KSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEF 94
            ||.|.|||||:..|| .:|.. ...|..::.||.::::.||....:|::..|.::|.|..:|:..
  Fly    57 GPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVM 121

Human    95 SGRGSFPVAEKVNKGLGILFSNGKR--------WKEI--------RRFCLMTLRNFG-------- 135
            |||..|....|       || .|:|        |.::        ||.|  :.|.|.        
  Fly   122 SGRPDFIRYHK-------LF-GGERSNSLALCDWSQLQQKRRNLARRHC--SPREFSCFYMKMSQ 176

Human   136 MGKRSIEDRVQEEARCLVEELRKTNASPCD--PTFILGCAP--CNVICSVIFHDRFDYKDQRFLN 196
            :|...:|...:|....||.      ..|.:  |..:..||.  ...:||:    ||||.|..|..
  Fly   177 IGCEEMEHWNRELGNQLVP------GEPINIKPLILKACANMFSQYMCSL----RFDYDDVDFQQ 231

Human   197 LMEKFNENLRILSSPWIQVCNNFPALIDYLPGSH-------NKIAENFAYIKSYVLERIKEHQE- 253
            :::.|:|..      | ::....|  :|:||..:       |||....:.|:.:::|||..|:| 
  Fly   232 IVQYFDEIF------W-EINQGHP--LDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHREL 287

Human   254 SLDMNSA-RDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYP 317
            |:|::.. |||.|..|..:.::|     :.:..::|..:.|..| |.......:...|..:.|..
  Fly   288 SVDLDEPDRDFTDALLKSLLEDK-----DVSRNTIIFMLEDFIG-GHSAVGNLVMLVLAYIAKNV 346

Human   318 EVTAKVQEEIECVV-GRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLI 381
            ::..::||||:.:: ..|||..:.|.:.||||.|.:.|:.||..  ...:||..|.|.....|.:
  Fly   347 DIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSS--SPIVPHVATEDTVISGYGV 409

Human   382 PKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKS-----GNFKKSD-----------------Y 424
            .|||.:..:...:..::|.:.||:.|:|..||:.|     .|.|.||                 :
  Fly   410 TKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPH 474

Human   425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITP 471
            |:|||.|||.|:|:.|.|...||.:..::|.:|:.|. :|..|.|:|
  Fly   475 FLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSH-NPSTIKISP 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP2C18NP_000763.1 p450 30..487 CDD:306555 139/502 (28%)
spoNP_001286943.1 p450 56..540 CDD:299894 139/502 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.