DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP2C18 and Cyp6a19

DIOPT Version :9

Sequence 1:NP_000763.1 Gene:CYP2C18 / 1562 HGNCID:2620 Length:490 Species:Homo sapiens
Sequence 2:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster


Alignment Length:505 Identity:116/505 - (22%)
Similarity:214/505 - (42%) Gaps:66/505 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     4 AVALVLCLSCLFLLSLWRQSS----GRGRLPSGPTPLPIIGNILQL-----DVKDMSKSLTNFSK 59
            |:.|.|.:..|.|::.|...:    .|..:|..|..:| :||..:|     ....:.::...|.|
  Fly     2 AILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIP-LGNTGELWRTMPLAGILKRTYLKFRK 65

Human    60 -VYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSF--PVAEKVNKGLGILFSNGKRWK 121
             ..||....|......:|:...:.||..||...::|..||.:  ...:.:...|..:  .|::||
  Fly    66 QTDGPFAGFYLYAMKYIVITDVDFVKTVLIRDFDKFHDRGVYHNEKDDPLTNNLATI--EGQKWK 128

Human   122 EIRRFCLMTLRNFGMGKR-SIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVI------- 178
            .:|:....|..:..|... |....|.:|...:|:|...:::...:.|.|:.....:||       
  Fly   129 NLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEKISSSSQTLEVTDIVSRFTSDVIGICAFGL 193

Human   179 -CSVIFHDRFDYKDQRFLNLMEK---FNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAY 239
             |:.:...:.::....:..|.|:   :..:|.|...|.:.|...|..|:..:...:.||.     
  Fly   194 KCNSLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQFLLPSVQKFYMKIV----- 253

Human   240 IKSYVLERIKEHQESLDMNSAR-----DFIDCFL-IKMEQEKHNQQSEFTVESLIATVTDMFGAG 298
                        |:::|....|     ||:|..: :|.:.:|.::::......:.|.....|.||
  Fly   254 ------------QDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAFVFFLAG 306

Human   299 TETTSTTLRYGLLLLLKYPEVTAKVQEEIECVV----GRNRSPCMQDRSHMPYTDAVVHEIQRYI 359
            .|..|||:.:.|..|....:|..|::.||:.|:    |:.....|||   :.|.:.|::|..|..
  Fly   307 FEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKLEYDSMQD---LFYMEKVINESLRKH 368

Human   360 DLLPTNLPHAVTCDVKFKN--YLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKS 422
            .:: .:|....|...:..|  |.|..||.::.|...:.|:.:.:|.||.|.|..|.::....:.:
  Fly   369 PVV-AHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPT 432

Human   423 DYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPI 472
            ..|:||.||.|.|:|....||::.:.|..::.||  :.::.||    ||:
  Fly   433 CAFLPFGAGPRNCIGLRFGRMQVIIGLALLIHNF--RFELHPK----TPV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP2C18NP_000763.1 p450 30..487 CDD:306555 109/475 (23%)
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 109/475 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4116
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.