DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRK2 and TPK2

DIOPT Version :9

Sequence 1:NP_001610.2 Gene:GRK2 / 156 HGNCID:289 Length:689 Species:Homo sapiens
Sequence 2:NP_015121.1 Gene:TPK2 / 855898 SGDID:S000006124 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:115/334 - (34%)
Similarity:184/334 - (55%) Gaps:30/334 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   187 TMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKR-IKMKQGETLALNERIMLSLVSTGD 250
            |::||.:.|.:|.|.||.|:..|....|:.||:|.|.|:: :||||.|. ..:||.||.||   :
Yeast    66 TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEH-TNDERRMLKLV---E 126

Human   251 CPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVY 315
            .||::.|...|.....:..::|.:.||:|...|.:...|.....:|||||:||.||::|...::|
Yeast   127 HPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIY 191

Human   316 RDLKPANILLDEHGHVRISDLGLACDFSKKKPHAS---VGTHGYMAPEVLQKGVAYDSSADWFSL 377
            |||||.|||||.:||::|:|.|    |:|:....:   .||..|:||||:.. ..|:.|.||:||
Yeast   192 RDLKPENILLDRNGHIKITDFG----FAKEVQTVTWTLCGTPDYIAPEVITT-KPYNKSVDWWSL 251

Human   378 GCMLFKLLRGHSPF---RQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGC 439
            |.:::::|.|::||   ...||.:|      .|...|..|..|.|::..||..|:..|:.||:|.
Yeast   252 GVLIYEMLAGYTPFYDTTPMKTYEK------ILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGN 310

Human   440 LGRGAQEVKESPFFRSLDWQMVFLQ----KYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLD 500
            |..|::::|..|:|..:.|:.:..:    .|.||:....|:.:..|.:.    :|:...||:..|
Yeast   311 LQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYP----EEQLDYGIQGDD 371

Human   501 SDQELYRNF 509
            ...|.:::|
Yeast   372 PYAEYFQDF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRK2NP_001610.2 N-terminal 1..190 1/2 (50%)
RGS_GRK2_GRK3 30..186 CDD:188701
STKc_GRK2 190..510 CDD:271125 114/331 (34%)
PH_GRK2_subgroup 553..670 CDD:269946
TPK2NP_015121.1 STKc_PKA_like 69..358 CDD:270732 108/303 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.