DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP2C19 and Cyp303a1

DIOPT Version :9

Sequence 1:NP_000760.1 Gene:CYP2C19 / 1557 HGNCID:2621 Length:490 Species:Homo sapiens
Sequence 2:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster


Alignment Length:518 Identity:145/518 - (27%)
Similarity:253/518 - (48%) Gaps:71/518 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     8 VLCLSCLLLLSIWRQSSGRGK-LPPGPTPLPVIGNILQID-----------IKDV-SKSLTNLSK 59
            |:.:.|..||:|......:.| .||||...|::|:.||:.           :.|| ::...|...
  Fly     5 VIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG 69

Human    60 IYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGR--GHFPLAERANRGFGIVFSNGKRWKE 122
            .||    |..|.:::|:.:..:.:.|.:.:  |:..||  |.|......|...|::.::|:.|.|
  Fly    70 FYG----LKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVE 128

Human   123 IRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEEL---------RKTKASPCDPT--FILGCAPCN 176
            .|||.|..|:|||..:..:.|.|..||.||:::|         ::|:....|.|  ::|     |
  Fly   129 QRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVL-----N 188

Human   177 VICSIIFQKRFDYKDQQFLNLME---KLNENIRIVSTPWIQICNNFPT---IIDYFPG------T 229
            .:..::..:|::....:...|:|   :|.:||.:|..    :.::||.   |...|.|      :
  Fly   189 TLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGA----LFSHFPLLRFIAPNFSGYNGFVES 249

Human   230 HNKLLKNLAFMESDI-LEKV--KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITA 291
            |..|   ..||..:| |.::  |.:.|      |||.:|.:| :.:.|..:::..|:.::|:...
  Fly   250 HRSL---YTFMSKEIELHRLTYKNYDE------PRDLMDSYL-RAQDEGNDEKGMFSDQSLLAIC 304

Human   292 ADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSP-CMQDRGHMPYTDAVVHEV 355
            .|:..||:|||:.:|.:..:.|:..||:..:..:||:.|:|..|.| ..:||..:||.:|:..|.
  Fly   305 LDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEA 369

Human   356 QRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFK 420
            .|...|....:||...||.:...|.|||.|.::.....:|.:..:||:||.|:|..:|.: |:.|
  Fly   370 VRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLK 433

Human   421 KSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDL-DTTPVVNGFASVPPF 482
            ....|.||..|:..|:|:.|.|..||:|.|.:||||.:.::  |..: :..|:....|:|.|:
  Fly   434 LPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI--PGQVPEEVPLEGATAAVKPY 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP2C19NP_000760.1 p450 30..487 CDD:365848 139/495 (28%)
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 135/479 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.