DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A7 and Cyp6d4

DIOPT Version :9

Sequence 1:NP_000756.3 Gene:CYP3A7 / 1551 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster


Alignment Length:517 Identity:174/517 - (33%)
Similarity:275/517 - (53%) Gaps:63/517 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    13 LLLAVSLI-LLYLYGTRTHGLFKKLGIP--GPTPLPF--LGNALSFRK--GYWTFDMECYKKYRK 70
            :||||:|: |.:.|..|.:..:::.|.|  ..:.:||  |.:.....|  |...:|:....|.| 
  Fly     5 ILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYDVYVKSKER- 68

Human    71 VWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPF-----GPVGFMKNAISIAEDEEWKRIR 130
            |.|||...:|.:.|.|.|:.:.||.:: ::.|.:|..:     .|:.  .|..|: ..:.|:.:|
  Fly    69 VLGIYLLFRPAVLIRDADLARRVLAQD-FASFHDRGVYVDEERDPLS--ANIFSL-RGQSWRSMR 129

Human   131 SLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRRE-AETG-KPVTLKHVFGAYSMDVITSTSFGVSI 193
            .:|||.|||||||.|.......||.:|.:|::| .|.| |.|.:|.|...|::|:|.||.||:.:
  Fly   130 HMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNYAIDIIASTIFGLDV 194

Human   194 DSLNNPQDPFVENTKKLL-------RFNPLDPFVLSIKVFPFLTPILEALNITVFPRKVISFLTK 251
            :|..||.:.|    :||:       |||.:  |.:.|.:.|.:...|..:.   |...|...:.:
  Fly   195 NSFENPDNKF----RKLVSLARANNRFNAM--FGMMIFLVPSIAQFLFRIG---FKNPVGLAMLQ 250

Human   252 SVKQIKEGRLKETQKH---RVDFLQLMIDSQNS--------------KDSETH-KALSDLELMAQ 298
            .||:..|.|    :||   |.|.|||:|..:|:              |..:.| |.:|...:.||
  Fly   251 IVKETVEYR----EKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHIKTISLEAITAQ 311

Human   299 SIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEID-TVLPNKAPPTYDTVLQLEYLDMVVNE 362
            :.||..||.|||.|..:|.|||||.:|::.:::|.|:| |:..|....|||::.::|:||:.|.|
  Fly   312 AFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSLNKMEFLDLCVQE 376

Human   363 TLRLFPVAMRLERVCKKDVEI--NGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKD 425
            |:|.:|....|.|.|.:|..:  ....||||..|:|..|.:|||.:|:.:||.:.|||||:::: 
  Fly   377 TIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETYDPERFSEESR- 440

Human   426 NIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEK 487
            |.:|..:.|||.|||.||..|...:|.|||::::||||:.:....::|  :....|:.|..|
  Fly   441 NYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEVMSRSEI--EFENSGIALIPK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:365848 165/490 (34%)
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 158/462 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.