DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A7 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_000756.3 Gene:CYP3A7 / 1551 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:526 Identity:167/526 - (31%)
Similarity:275/526 - (52%) Gaps:48/526 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     9 VETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGN----ALSFRKGY--WTFDMECYKK 67
            ||..:.:|...:|||.:...|.|.|.|.|:....|:|.|||    .|..::.|  .:.|:....|
  Fly     4 VELSIFVAFIGLLLYKWSVYTFGYFSKRGVAHEKPIPLLGNIPWSVLMGKESYIKHSIDLHLRLK 68

Human    68 YRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGF------MKNAISIAEDEEW 126
            ..||:|:::.:.|:..::||::|:.|.:|. :..|||.|.....||      .|:.:|: .|..|
  Fly    69 QHKVYGVFNLRDPLYYLSDPELIRQVGIKN-FDTFTNHRKGITEGFNDTSVISKSLLSL-RDRRW 131

Human   127 KRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKHVFGAYSMDVITSTSFG 190
            |::||.|:|||||.|:::|..:|.......|..::|:.:.| ..:.||..|..|:.|||.:.:||
  Fly   132 KQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFFTRYTNDVIATAAFG 196

Human   191 VSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPF-LTP-ILEALNITVFPRKVISFLTKSV 253
            :.::|..:|.:.|....:::..|.    |...:||..: |.| :::||.:.|.....:.:..|.|
  Fly   197 IQVNSFKDPNNEFFSIGQRISEFT----FWGGLKVMLYILMPKLMKALRVPVMDMNNVDYFKKLV 257

Human   254 KQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETH----------KA-LSDLELMAQSIIFIFAGY 307
            ....:.| ||....|.|.:.|::::|....:|..          || .:|.:|:||.::|..||:
  Fly   258 FGAMKYR-KEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQQDKAEFNDDDLLAQCLLFFSAGF 321

Human   308 ETTSSVLSFIIYELATHPDVQQKVQKEIDTVLP--NKAPPTYDTVLQLEYLDMVVNETLRLFPVA 370
            ||.::.|||..|||..:|:||:|:..||..|..  .:.|..|||::.::||:.||:|:||.:|.|
  Fly   322 ETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEKPLDYDTLMGMKYLNCVVSESLRKWPPA 386

Human   371 MRLERVCKKDVEINGMFIPKGVVVM---------IPSYVLHHDPKYWTEPEKFLPERFSKKNKDN 426
            ..::|:|..|.::..   .:|.||:         |....|||||..:.|||:|.||||.:::|..
  Fly   387 FIVDRMCGSDFQLKD---EEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERFDEEHKHE 448

Human   427 IDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGL-LLTEKPIV 490
            |..:.|.|||.|.|:|||.|.||:.:|..:.:::..:..||...|...:.....|. ||..:...
  Fly   449 IRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTDRTPADMMSSISGFRLLPRELFW 513

Human   491 LKAESR 496
            .|.|||
  Fly   514 CKLESR 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:365848 152/490 (31%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 152/486 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 262 1.000 Domainoid score I1946
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 277 1.000 Inparanoid score I2940
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm41379
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.