DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A7 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_000756.3 Gene:CYP3A7 / 1551 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:514 Identity:141/514 - (27%)
Similarity:245/514 - (47%) Gaps:58/514 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    12 WLLLAVSLILLYLYGTRTHGLFKKLGIP-----GPTPLPFLGNALSFRKGYWTFDMECYKKYR-- 69
            |||| ::::.|..:....:..|:..|||     ..:|:..||..|..|..:.....:.|...|  
  Fly     5 WLLL-LTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRNG 68

Human    70 --KVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAIS--IAEDEEWKRIR 130
              |:.|.:..|.|.|.:.||::|:.||:|. ::.|.||......|....|::  :|:...||..|
  Fly    69 QAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132

Human   131 SLLSPTFTSGKLK-----EMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFG 190
            ..:|..||||:::     :|:.:.:.....|.|.|....|...|  |..:...|:.||..:..:.
  Fly   133 QCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLP--LGRMCQLYTTDVTGNLFYS 195

Human   191 VSIDSLNNPQDPFVENTKKLLRFNP---LDPFVLSIKVFPFLTPILEALNITVFPRKVISFLTKS 252
            :::..|...:...:..||:|...||   ||  .:|:...|..|.:|:       |:.......:.
  Fly   196 LNVGGLRRGRSELITKTKELFNTNPRKVLD--FMSVFFLPKWTGVLK-------PKVFTEDYARY 251

Human   253 VKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFI 317
            ::.:.:...:.|:...::.||....|::|.....|...    :.:|:.|.:.||:||:|:::.|.
  Fly   252 MRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDF----VASQAGIILLAGFETSSALMGFT 312

Human   318 IYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVE 382
            :||||..||:|::::.|:.....:.|..:|||::.|.||.||..|.|||:|.|..:.|.|.....
  Fly   313 LYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSAS 377

Human   383 IN-------GMFIPKGVVVMIPSYV----LHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFG 436
            ..       ...:|.|    :|:|:    ||.|.::|.||..|.||||..:...:|.|..|.|||
  Fly   378 EGFSLQPHVDFIVPPG----MPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFG 438

Human   437 SGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAES 495
            :||..|||.|..::.:||.:|.:|:.:..:.|:.|  ..::||     ..|..:|::|:
  Fly   439 AGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERT--VSEIRF-----NPKSFMLESEN 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:365848 131/482 (27%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 130/478 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.