DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A7 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_000756.3 Gene:CYP3A7 / 1551 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:519 Identity:180/519 - (34%)
Similarity:275/519 - (52%) Gaps:50/519 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    11 TWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTFDM--ECYKKYR---K 70
            |..|:.|.|.|.|....:....:|:.|:|..||||.:||.....|.|...|:  ..|||::   .
  Fly     4 TIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKYHFRDINQRIYKKFKGQGP 68

Human    71 VWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPF-----GPVGFMKNAISIAEDEEWKRIR 130
            :.|:|...:....|||.|.||.|::|: :|.|.:|..|     .|   :...:...|.|||:.:|
  Fly    69 IAGMYMFFKRTALITDLDFIKQVMIKD-FSYFQDRGAFTNPRDDP---LTGHLFALEGEEWRAMR 129

Human   131 SLLSPTFTSGKLKEMVPIIA----QYGDVLVRNLRR-EAETGKPVTLKHVFGAYSMDVITSTSFG 190
            ..|:|.|||||:|:|..:|.    :.||.:.:.::. :.|.|. |.:|.:...::.|||.|.:||
  Fly   130 HKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGN-VEIKDLCARFTTDVIGSCAFG 193

Human   191 VSIDSLNNPQDPFVENTKKLL---RFNPLDPFVLSIKVFPFLTP-ILEALNITVFPRKVISFLTK 251
            :..:||.:|...|.:..:::.   |.:.|      ::.|.|... :...|.|.|.|..:..|...
  Fly   194 LECNSLQDPSAEFRQKGREIFTRRRHSTL------VQSFIFTNARLARKLRIKVLPDDLTQFFMS 252

Human   252 SVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHK---------ALSDLELMAQSIIFIFAGY 307
            :||...:.|||...| |.||::.||:.: ::|.|..|         .|:..::.||:.:|..||:
  Fly   253 TVKNTVDYRLKNGIK-RNDFIEQMIELR-AEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFFVAGF 315

Human   308 ETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPN--KAPPTYDTVLQLEYLDMVVNETLRLFPVA 370
            ||:||.:|..:||||..||:||::::||::||.|  .....||.:.|:.|||.|::||||..|:.
  Fly   316 ETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLL 380

Human   371 MRLERVCKKDVEI--NGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYT 433
            ..|.|...||.:|  :.:.:.||::.:||.:.:||||:.:.|||||.|.||..:...|..|..|.
  Fly   381 PHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKNRHPMAYL 445

Human   434 PFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPL---KLRFGGLLLTEKPIVLKAE 494
            |||.|||||||:||..:..|:.||.:|:.|.|.....|.:||   |..|  ||.|...|.||.|
  Fly   446 PFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSF--LLTTNDGIYLKVE 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:365848 169/487 (35%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 170/488 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8447
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.