DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A7 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_000756.3 Gene:CYP3A7 / 1551 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:407 Identity:110/407 - (27%)
Similarity:195/407 - (47%) Gaps:48/407 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   113 FMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFG 177
            |:.:.:.|:.|::|...|..|:|.|....|:..:.|..:.....::.|  :...|..:.|..:..
  Fly   126 FLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKIL--DKNVGFELELNQIIP 188

Human   178 AYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRF---------NPLDPF------VLSIKVFP 227
            .::::.|..|:.||.:|.::...    |..|.:..|         |||..|      ....|.:.
  Fly   189 QFTLNNICETALGVKLDDMSEGN----EYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYS 249

Human   228 FLTPILEALNITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSE---THKA 289
            .:...:...:..:..||...|..|.:.|:.|...|:.        ..|:|:..:.::|   .|:.
  Fly   250 RILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQR--------YAMLDTLLAAEAEGKIDHQG 306

Human   290 LSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVL--- 351
            :.|     :...|:|.||:|||:.|.|.:..||.|.|||::..:|:..:     |...|.|.   
  Fly   307 ICD-----EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDL-----PEDIDEVSMFQ 361

Human   352 --QLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKF 414
              :|.:|:.|:.|:|||||.|..:.|.|.::..:||:.:||...:.|..|.:..|.:::.:|.:|
  Fly   362 FNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQF 426

Human   415 LPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRF 479
            |||||..:|..|..|:.:.||.:|||||||.:|.::.:|:.|..|::||...|..:.: .|....
  Fly   427 LPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLE-DLTFEN 490

Human   480 GGLLLTEKPIVLKAESR 496
            |.:|.|::.|.:|.|:|
  Fly   491 GIVLRTQQNIKVKFEAR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:365848 107/401 (27%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 107/402 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.