DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A7 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_000756.3 Gene:CYP3A7 / 1551 HGNCID:2640 Length:503 Species:Homo sapiens
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:533 Identity:147/533 - (27%)
Similarity:248/533 - (46%) Gaps:87/533 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     7 LAVETWLLLAVSL-----ILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKG---YWTFDME 63
            ||:..::|.|..|     ||.:|...|    |.|. :||||....:.|.   :||   .|.  .|
  Fly     4 LALVAFVLWAAFLRYLPKILNFLRLQR----FAKT-LPGPTIGELIANV---KKGEILNWL--KE 58

Human    64 CYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRR------PFGPVGFMKNAISIAE 122
            ..:|:..|:.|:..:..|:..|||:.||.:|...  .:.|..|      |:...|.:.|.     
  Fly    59 LREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNN--QLLTKSRNYELLEPWLGKGLLTNG----- 116

Human   123 DEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITST 187
            .|.|.|.|.||:|.|....|.|....:.:...:|||.||.:| .|:...:......:::|.|..|
  Fly   117 GESWHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKA-NGESFDIYPYITLFALDAICET 180

Human   188 SFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITVFPR--------- 243
            :.|:...:.......:|:..:.:.|       |:..:.|.|    .:.||: .|..         
  Fly   181 AMGIKKHAQLQSDSEYVQAVQSICR-------VMHKQSFSF----WQRLNV-FFKHTKPGKEREA 233

Human   244 --KVISFLTKSVKQIKEGRLKETQ--------------KHRVDFLQLMIDSQNSKDSETHKALSD 292
              ||:...|..|.:::..:|.:.:              |.|:.||.:::.:|....:|    |||
  Fly   234 ALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAE----LSD 294

Human   293 LELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLD 357
            .::..:...|:|.|::||||.::|.:..|:.:|||||:..:|...:...:..       .:.||:
  Fly   295 TDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKE-------SMPYLE 352

Human   358 MVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKK 422
            .|:.||||::|......|...:|:|:..:.:|||..:....|:||.|||.:.:||:|.|:|| ..
  Fly   353 AVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRF-LV 416

Human   423 NKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTE- 486
            |:..:.|:.:..|.:|||||||.:||::.:|.:|..:|:::.|.|.|:.| |..|   ..|:|: 
  Fly   417 NEKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQ-PKPL---AELVTKS 477

Human   487 -KPIVLKAESRDE 498
             ..|.|:...|||
  Fly   478 GNGIRLRILPRDE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A7NP_000756.3 p450 39..492 CDD:365848 132/488 (27%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 128/471 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.