DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hspb1 and CG14207

DIOPT Version :9

Sequence 1:NP_038588.2 Gene:Hspb1 / 15507 MGIID:96240 Length:209 Species:Mus musculus
Sequence 2:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster


Alignment Length:88 Identity:38/88 - (43%)
Similarity:58/88 - (65%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse   100 RVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPE 164
            ::..||:.:||||:.|||.:..:.:..||||:.|... :.|.:.|::.||.||:|..:.||||.:
  Fly   105 KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKD 168

Mouse   165 GTLTVEAPLPKAVTQSAEITIPV 187
            |.|||:|||| |:| :.|..||:
  Fly   169 GVLTVDAPLP-ALT-AGETLIPI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hspb1NP_038588.2 Interaction with TGFB1I1. /evidence=ECO:0000250 74..209 38/88 (43%)
ACD_HspB1_like 88..173 CDD:107230 30/72 (42%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.