DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsd17b4 and CG11151

DIOPT Version :9

Sequence 1:NP_032318.2 Gene:Hsd17b4 / 15488 MGIID:105089 Length:735 Species:Mus musculus
Sequence 2:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster


Alignment Length:116 Identity:55/116 - (47%)
Similarity:73/116 - (62%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse   621 LQSALVFGEIGRRLKSVGREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPAKG-SAD 684
            |||..||.:|...||. .....|..|.||.:.|||.|.||.:||:|.|  :.:.|:|||:| ..|
  Fly     3 LQSDAVFQKIIDGLKE-NEAKAKAVNGVFLYKITKDGKVAKEWTLDCK--NAKAYEGPAQGIKVD 64

Mouse   685 VTIIISDEDFMEVVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL 735
            .|:.::|||.:::..|||:||.||..|:||..|||||:|||..:||..|||
  Fly    65 TTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAKL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsd17b4NP_032318.2 (3R)-hydroxyacyl-CoA dehydrogenase 1..305
hydroxyacyl-CoA-like_DH_SDR_c-like 5..254 CDD:187611
fabG 6..226 CDD:235546
Enoyl-CoA hydratase 2 321..621 55/116 (47%)
PLN02864 329..604 CDD:178455
hot_dog <394..443 CDD:294345
(3R)-3-hydroxydecanoyl-CoA binding. /evidence=ECO:0000250 405..406
HDE_HSD 484..604 CDD:239532
(3R)-3-hydroxydecanoyl-CoA binding. /evidence=ECO:0000250 509..514
SCP2 633..730 CDD:280250 44/97 (45%)
Microbody targeting signal. /evidence=ECO:0000255 733..735 1/1 (100%)
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 46/102 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7767
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.