DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsd11b2 and CG8888

DIOPT Version :9

Sequence 1:NP_032315.2 Gene:Hsd11b2 / 15484 MGIID:104720 Length:386 Species:Mus musculus
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:366 Identity:105/366 - (28%)
Similarity:160/366 - (43%) Gaps:52/366 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    29 RLGRPLL----AALA---LLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARP-----PRLPVA 81
            ||..|.|    ||:.   ||.|||         .:::...|...|.||:.:...     .::..:
  Fly    39 RLFMPFLFCQAAAIVTSHLLHALD---------ISSISTFAVFVWFALATVGAVLFYHFVKVSAS 94

Mouse    82 TRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNSP-----GALELRDLCSPRLKLLQMDLTK 141
            .:.||||||:.......|||||.:||||.|   ..|:|     .|..|:::.|.|:|||.:|:|.
  Fly    95 GKGVLITGCEAPLAWYLAKKLDDLGFTVYA---GFNTPIEESDEAKILKEVTSGRMKLLHLDVTS 156

Mouse   142 AEDISRVLEITKAHT--ASTGLWGLVNNAGLNIVVADVELSPVATFRKCMEVNFFGALELTKGLL 204
            .:.|.........|.  .:.|||.:|:.|.. |.:.::|..|.|..||.:::|..|:..||:..|
  Fly   157 EKTILEAARYVSQHLPHGAEGLWSVVHCAHW-IALGELEWIPFAVLRKSLDLNLLGSARLTQIFL 220

Mouse   205 PLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFGCELLPWGIKVSIIKPGCFK--T 267
            ||:|.:.||:|.:.|....:|.|.......::||:.........|:...|:.||::..|.|.  .
  Fly   221 PLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGN 285

Mouse   268 DAVTNVNLWEKRKQLLLANIPRELLQAYGEDYIEHVHGQFLNSLRMALPDLSPVVDAIIDALLAA 332
            ..:....|.::.|| :...:..|..:.|||||.|..........|.| .|:.|.:..:|||:...
  Fly   286 GWLNETELRDQAKQ-MWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQA-ADIQPTLRVLIDAVTRT 348

Mouse   333 QPRSRYYPGRGLGLMYFIHHYLPEGLRRCFLQNFFINHLLP 373
            .|.:||.|             :....|   ||.|...||.|
  Fly   349 FPMARYTP-------------VTSSER---LQIFLAEHLAP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsd11b2NP_032315.2 type2_17beta_HSD-like_SDR_c 83..363 CDD:187665 84/288 (29%)
adh_short 83..278 CDD:278532 63/203 (31%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 90/300 (30%)
adh_short 96..293 CDD:278532 62/200 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5728
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.