DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsd11b1 and CG31937

DIOPT Version :9

Sequence 1:XP_006497291.1 Gene:Hsd11b1 / 15483 MGIID:103562 Length:304 Species:Mus musculus
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:248 Identity:67/248 - (27%)
Similarity:113/248 - (45%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 YLLPILVLFLAYY-------------YYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMG 70
            :||.:|||:...|             :|.:........::|:.|.:||||.||||.:|..|::.|
  Fly     6 FLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHG 70

Mouse    71 AHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTME------DMTFAEQFIVKAGKLMG---GLD 126
            ..:||:||..|.|::|...||    |:|..:..|.:      ||...::.......::.   .||
  Fly    71 VKLVLSARRLEQLEQVQEECL----AAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLD 131

Mouse   127 MLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGS---IAVISSLAGKMT 188
            :|:.|.......|....:|...|.:.|::..:.|.:|...:....:.||.   ||..||:||...
  Fly   132 VLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSP 196

Mouse   189 QPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISG 241
            .|....|.|:|.||:.:..:::.|:  .|::||  |...|.|.|:...:..:|
  Fly   197 VPFSPTYCAAKHALNAYLLSLKVEM--RKLDVS--LFAPGPIATDFLQEAFTG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsd11b1XP_006497291.1 11beta-HSD1_like_SDR_c 44..291 CDD:187593 60/210 (29%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/210 (29%)
adh_short 47..245 CDD:278532 58/205 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.