DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st1 and Hs3st-B

DIOPT Version :9

Sequence 1:NP_034604.1 Gene:Hs3st1 / 15476 MGIID:1201606 Length:311 Species:Mus musculus
Sequence 2:NP_001259702.1 Gene:Hs3st-B / 32918 FlyBaseID:FBgn0031005 Length:384 Species:Drosophila melanogaster


Alignment Length:289 Identity:117/289 - (40%)
Similarity:170/289 - (58%) Gaps:24/289 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    28 GLKQQELLRKVIILPEDTGEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVH 92
            |..:.:|||:..:.|            ::.||.|:||||:|.|||||||.:.|||||.||.:|||
  Fly   113 GAPKYQLLRQQGLRP------------SRHLPDTLIIGVKKSGTRALLEFIRLHPDVRAAGSEVH 165

Mouse    93 FFDWEEHYSQGLGWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERV 157
            |||  .||.:||.||...||::...|:|:||||:||.:.:||:|::.|||..:||:::|||..|.
  Fly   166 FFD--RHYQRGLRWYRHHMPYTIEGQITMEKTPSYFVTKEVPQRVYHMNPATKLLIVVRDPVTRA 228

Mouse   158 LSDYTQVLYNHLQKHKPYPPIEDLLMRDGR---LNLDYKALNRSLYHAHMLNWLRFFPLGHIHIV 219
            :|||||.    ..|.......|.|...:|.   ::.::..:...:|..::..||.:|||..:..:
  Fly   229 ISDYTQA----ASKKADMKLFEQLAFVNGSYSVVDTNWGPVKIGVYARYLERWLLYFPLSQLLFI 289

Mouse   220 DGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDS---GKDRCLHESKGRAHPQV 281
            .|:|||.||..||.:|:.||.|...:...:||||.||||.||..|   ....||.::|||.||.:
  Fly   290 SGERLIMDPAYEIGRVQDFLGLKRVVTEKHFYFNATKGFPCLFKSEARSTPHCLGKTKGRNHPHI 354

Mouse   282 DPKLLDKLHEYFHEPNKKFFKLVGRTFDW 310
            ||..:::|.|::...|.||::|.|..|.|
  Fly   355 DPGAIERLREFYRPFNNKFYQLTGINFAW 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st1NP_034604.1 Sulfotransfer_1 58..295 CDD:366246 105/242 (43%)
Hs3st-BNP_001259702.1 Sulfotransfer_1 131..368 CDD:279075 105/242 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61370
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.