DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxd8 and Antp

DIOPT Version :9

Sequence 1:NP_032302.2 Gene:Hoxd8 / 15437 MGIID:96209 Length:289 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:295 Identity:93/295 - (31%)
Similarity:114/295 - (38%) Gaps:99/295 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 NPLYSKYKAAAAAAAAAAAAAAGEAINPTYYDCHFAPEVSGRHAAALQLYGNSAAGFPH--AHP- 68
            :|...:.:....|:....||..|..:.|.........::||.|.       |:....||  .|| 
  Fly   148 HPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHM-------NAQMTLPHHMGHPQ 205

Mouse    69 ----------------HPHPHPS---------PPPGCGGGGGPGPGQDYFHAGAGSPTAAYQAAP 108
                            |.:.|..         ||.|       .|.|...|.|.|.|  ......
  Fly   206 AQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVG-------APPQGMMHQGQGPP--QMHQGH 261

Mouse   109 PPPHPPPPPPPPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDH 173
            |..|.||.                                       |.|:.:|           
  Fly   262 PGQHTPPS---------------------------------------QNPNSQS----------- 276

Mouse   174 LNQSSSPSQMFPWMRPQ--AAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHTLALTE 236
               |..||.::||||.|  ....|:||||||:|:|||||||||.||.||||:||||::|.|.|||
  Fly   277 ---SGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTE 338

Mouse   237 RQVKIWFQNRRMKWKKENNKDKFPASRPEAKDGDP 271
            ||:|||||||||||||||.....|.|..|..:..|
  Fly   339 RQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxd8NP_032302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..125 19/90 (21%)
COG5576 139..272 CDD:227863 64/135 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..184 4/21 (19%)
Antp-type hexapeptide 183..188 2/4 (50%)
Homeobox 199..251 CDD:278475 41/51 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..289 7/20 (35%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 45/213 (21%)
Homeobox 301..354 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.