Sequence 1: | NP_032302.2 | Gene: | Hoxd8 / 15437 | MGIID: | 96209 | Length: | 289 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
Alignment Length: | 329 | Identity: | 83/329 - (25%) |
---|---|---|---|
Similarity: | 107/329 - (32%) | Gaps: | 113/329 - (34%) |
- Green bases have known domain annotations that are detailed below.
Mouse 18 AAAAAAAAAAAGEAINPTYY--------------------DCHFAPEVSGRHAAALQLYGNSAAG 62
Mouse 63 FPHAHPHPH----------PHPSPP---PGCGGGGGPGP------------GQDYFH-------- 94
Mouse 95 ---AGAG-------SPTAAYQAAPPPPHPPPPP-------PPPP-----------CGGIACHG-- 129
Mouse 130 ---EPAKFYGYDNLQRQPIFTTQQEAELVQYPDC--------KSSSGNIGEDPDHLNQSSSPSQM 183
Mouse 184 FPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHTLALTERQVKIWFQNRRM 248
Mouse 249 KWKK 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hoxd8 | NP_032302.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 62..125 | 26/123 (21%) | |
COG5576 | 139..272 | CDD:227863 | 40/122 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 162..184 | 7/21 (33%) | |||
Antp-type hexapeptide | 183..188 | 0/4 (0%) | |||
Homeobox | 199..251 | CDD:278475 | 25/51 (49%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 252..289 | 0/1 (0%) | |||
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 24/50 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |