DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxd4 and Ubx

DIOPT Version :9

Sequence 1:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:258 Identity:83/258 - (32%)
Similarity:111/258 - (43%) Gaps:82/258 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 GGYLGEQGAD--YYGSGAQGADFQPSGLYPRPDFGEQPFGGGGPGPGSALPARGHGQEPSGPGSH 88
            ||||...|..  .:..|:.|.:...||       |....||...|.|.|           |.|:.
  Fly   165 GGYLDTSGGSPVSHRGGSAGGNVSVSG-------GNGNAGGVQSGVGVA-----------GAGTA 211

Mouse    89 YGAPGERCPAPPPAPLPGARACSQPTGPKQPPPGTALKQPA--VVYPWM------------KKVH 139
            :.|   .|      .:.||.|        |....::|.|.:  ..||||            .|:.
  Fly   212 WNA---NC------TISGAAA--------QTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIR 259

Mouse   140 ---------------------VNSVNPNY--TGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRR 181
                                 ..|:.|::  |.|..:|.|..|||.|.||||||||.|.||||||
  Fly   260 SDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRR 324

Mouse   182 RIEIAHTLCLSERQIKIWFQNRRMKWKKD--------HKLPNTKGRSSSSSSCSSSAAPGQHL 236
            |||:||.|||:||||||||||||||.||:        .:....:.:.:::::.:::|..|.||
  Fly   325 RIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGHL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 19/96 (20%)
Antp-type hexapeptide 131..136 4/16 (25%)
Homeobox 155..208 CDD:278475 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 4/35 (11%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.