DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxd4 and Scr

DIOPT Version :9

Sequence 1:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:250 Identity:96/250 - (38%)
Similarity:120/250 - (48%) Gaps:69/250 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 VNSKYVDPKFPPCE------EYLQGGYLGEQGADYYGSGAQGADFQPSGLYPRPDFGEQPFGGGG 66
            ::::.:.||..|..      ..|..|.||  |:....:.|.|.:...||            .|..
  Fly   210 LSTRDISPKLSPSSVVESVARSLNKGVLG--GSLAAAAAAAGLNNNHSG------------SGVS 260

Mouse    67 PGPGSA-----LPARGHGQEPSGPGSHYGAPGERCPAPPPAPLPGARACSQPTGPKQPPPGTALK 126
            .|||:.     .|..|.....|..|:..|:                   ||.:       |...|
  Fly   261 GGPGNVNVPMHSPGGGDSDSESDSGNEAGS-------------------SQNS-------GNGKK 299

Mouse   127 QPAVVYPWMKKVHV--NSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTL 189
            .|..:|||||:||:  ::||.|   ||.||.||:|||.|.|||||||||||||||||||||||.|
  Fly   300 NPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 361

Mouse   190 CLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSCSSSAAPGQHLQPMAKDHH 244
            ||:|||||||||||||||||:||:            .|.:..| .|:.|....:|
  Fly   362 CLTERQIKIWFQNRRMKWKKEHKM------------ASMNIVP-YHMGPYGHPYH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 17/99 (17%)
Antp-type hexapeptide 131..136 3/4 (75%)
Homeobox 155..208 CDD:278475 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 6/34 (18%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.