DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxd3 and Antp

DIOPT Version :9

Sequence 1:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:295 Identity:89/295 - (30%)
Similarity:119/295 - (40%) Gaps:82/295 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 QLTLELPECTMQKAAYYENPGLFGGYGYSKATDTYGYSTPHQPYPPPAAANSLDSDYPSSACSIQ 71
            ||..:||:.|.|                        .:.|.|....|..       |.|  |.:|
  Fly   134 QLQQQLPQVTQQ------------------------VTHPQQQQQQPVV-------YAS--CKLQ 165

Mouse    72 SS-----------APLRAPAHKGAELNGSCMRP-GTGNSQGGGG--------------GNQPPGL 110
            ::           :|.......|..:|.....| ..|:.|...|              .:...|:
  Fly   166 AAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGM 230

Mouse   111 NSEQQ--PPQPPPPPPPTLPPSSPTNPGSGVPAKKTKGGLSASSSSSTISKQIFPWMKESRQNSK 173
            ..:|.  ||...||.........|.....|.|.:.|....:.:|.||.:...::|||:.  |..|
  Fly   231 YQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRS--QFGK 293

Mouse   174 QKNSCATSGENCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQ 238
                       |:::       ||.|..||..|.:||||||||||||.|.||:|:|:.|.|||||
  Fly   294 -----------CQER-------KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQ 340

Mouse   239 IKIWFQNRRMKYKKDQKAKGILHSPAGQSPERSPP 273
            |||||||||||:||:.|.||...| .|:..|.:||
  Fly   341 IKIWFQNRRMKWKKENKTKGEPGS-GGEGDEITPP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 34/181 (19%)
Antp-type hexapeptide 161..166 2/4 (50%)
Homeobox 199..251 CDD:278475 38/51 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 6/16 (38%)
DUF4074 370..431 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/166 (20%)
Homeobox 301..354 CDD:395001 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.