DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxd3 and zen2

DIOPT Version :9

Sequence 1:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:234 Identity:78/234 - (33%)
Similarity:103/234 - (44%) Gaps:71/234 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse   195 SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGI 259
            |||.|||::|.||:|||:|||.|:||.|.||:|::..|.|||||:||||||||||.||....||.
  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGA 107

Mouse   260 LHS-----P-AGQSPE--------------------RSPPLGGAAGHVAYSGQLPPVPGLAYD-- 296
            :.:     | :.||.|                    .:.||......|...||:.| |..:||  
  Fly   108 IGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITP-PYQSYDYL 171

Mouse   297 ---APSPPAFAKSQPNMYGLAAYTAPLSSCLPQQKRYPAPEFEPHPMASNGGGFASANLQGSP-V 357
               :|.|.|                     |||   .|..||:        ..:||:.|...| :
  Fly   172 HEFSPEPMA---------------------LPQ---LPFNEFD--------ANWASSWLGLEPTI 204

Mouse   358 YVGGNFVDSMAPTSGPVFNLGHLSHPSSAS------VDY 390
            .:..|.::........:.|....|:.||||      |||
  Fly   205 PIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 2/2 (100%)
Antp-type hexapeptide 161..166
Homeobox 199..251 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 7/47 (15%)
DUF4074 370..431 CDD:290032 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.