DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxd1 and Antp

DIOPT Version :9

Sequence 1:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:266 Identity:78/266 - (29%)
Similarity:102/266 - (38%) Gaps:80/266 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse    57 LPLATARPTPSPPAGPAQSPVPQPAAPRYAPCTLEGAY-ERGAAPASAAEYGFLGSGPAFD---- 116
            ||..|.:.|  .|....|.||.      ||.|.|:.|. ..|..|..       ||.|..|    
  Fly   139 LPQVTQQVT--HPQQQQQQPVV------YASCKLQAAVGGLGMVPEG-------GSPPLVDQMSG 188

Mouse   117 --------FPGALGRAADEGG-----------AHVHYATSAVFSGGGSFLLSGQVDFAAFGEP-- 160
                    .|..:|....:.|           .|.::....::        ..|......|.|  
  Fly   189 HHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMY--------QQQSGVPPVGAPPQ 245

Mouse   161 -------GPFPACLKEPADGHPGPFQTVSPAPGACPKPASPTSSLPAAHSTFEWMKVKRNAPKKS 218
                   ||     .:...||||  |...|:    ..|.|.:|.:|:  ..:.||:         
  Fly   246 GMMHQGQGP-----PQMHQGHPG--QHTPPS----QNPNSQSSGMPS--PLYPWMR--------- 288

Mouse   219 KLSEYGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMK 283
              |::|........|..::..|..|||||||||:||||.||||||:.|.|.:.|:||||||||||
  Fly   289 --SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351

Mouse   284 QKKRER 289
            .||..:
  Fly   352 WKKENK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 13/46 (28%)
Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/183 (18%)
Homeobox 301..354 CDD:395001 34/52 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.