DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxd1 and Scr

DIOPT Version :9

Sequence 1:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:262 Identity:75/262 - (28%)
Similarity:103/262 - (39%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    39 ALQPAFPLGSGDGAFVSC---LPLATARPTPSPPAGPAQSPVPQPAAPRYAPCTLEGAYERGAAP 100
            |..|..|.|||.|.....   ...|.:....|......|....:..:|:.:|.::..:..|    
  Fly   170 ANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVAR---- 230

Mouse   101 ASAAEYGFLGSGPAFDFPGALGRAADEGGAHVHYATSAVFSGGGSFLLSGQVDFAAFGEPGPFPA 165
              :...|.||        |:|..||...|.:.:::.|.| |||                ||....
  Fly   231 --SLNKGVLG--------GSLAAAAAAAGLNNNHSGSGV-SGG----------------PGNVNV 268

Mouse   166 CLKEPADGHPGPFQTVSPAPGACPKPASPTSSLPAAHSTFEWMK--------VKRNAPKKSKLSE 222
            .:..|..|............|:.....:...:.|   ..:.|||        |..|...|.:   
  Fly   269 PMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPP---QIYPWMKRVHLGTSTVNANGETKRQ--- 327

Mouse   223 YGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKR 287
                      ||:::..|..|||||||||:||||.||||||:.|.|.:.|:||||||||||.||.
  Fly   328 ----------RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 382

Mouse   288 ER 289
            .:
  Fly   383 HK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 6/45 (13%)
Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.